#sleep-health — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #sleep-health, aggregated by home.social.
-
DATE: May 17, 2026 at 08:00PM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: Poor sleep and endless video scrolling form a predictable behavioral loop
URL: https://www.psypost.org/how-daylight-exhaustion-secretly-fuels-endless-nighttime-scrolling/
Scrolling through endless feeds of short videos can disrupt a good night of sleep, but poor sleep might also fuel the drive to keep scrolling in a continuous loop. Researchers found that daytime tiredness acts as a gateway symptom, making individuals more vulnerable to losing control over their video consumption. The study was published in the journal Personality and Individual Differences.
Short-form media platforms have changed how people consume digital content. Applications feature brief clips paired with advanced recommendation codes that learn exactly what users want to watch. This specific design lowers the mental barrier to entry and promotes continuous viewing. Viewers often experience a state of deep absorption and completely lose track of time.
Medical manuals do not officially recognize short video consumption as a formal psychiatric disorder. Mental health professionals instead describe excessive, uncontrolled viewing habits as a behavioral problem. People report feelings of mental withdrawal when separated from the applications. They also use the content as a method of escapism, dodging daily responsibilities in favor of an easily accessible digital distraction.
A healthy sleep cycle maintains physical endurance, regulates emotions, and keeps mental functions sharp. College students around the world frequently struggle to maintain consistent resting schedules. Excessive screen time before bed provides mental stimulation that disrupts these natural rest cycles. The light emitted by phones and the highly engaging content tend to delay the onset of sleep.
Xiaoqiong Li, a psychology researcher at South China Normal University, led a team to investigate how specific viewing habits and sleep issues influence one another over time. Prior research often treated video consumption and sleep as broad, single categories. Li and colleagues wanted to break down these large concepts into individual, specific symptoms. They aimed to map exactly which parts of a sleep disorder lead to specific video habits.
The research team recruited a large sample of college students in central China. They surveyed 6,691 students at two different points in time. The two surveys were spaced exactly three months apart. This three-month interval aligns with standard medical criteria for diagnosing chronic resting issues, as opposed to temporary bouts of insomnia.
The students answered questions about their short video viewing habits and any signs of insomnia. The sleep questions covered nighttime struggles like waking up too early, as well as daytime issues like bad moods and sluggishness. The video questions evaluated feelings of anxiety when offline, using applications to relieve loneliness, and drops in personal productivity.
The researchers analyzed the survey data using a specialized statistical mapping technique. Instead of giving each student a single total score for sleep or video use, they treated every individual symptom as a point in a web. They examined how tightly connected each point was to the others across the three-month gap. This approach allowed them to spot the specific symptoms that pushed the entire network forward over time.
The analysis showed a two-way street between video applications and insomnia. Problematic viewing habits predicted an increase in sleep troubles three months later. Students who reported a drop in personal efficiency due to their screen habits later experienced shorter sleep durations. Extended viewing sessions simply crowd out the hours normally reserved for resting.
The reverse relationship proved to be much stronger. Suffering from certain insomnia symptoms made students highly susceptible to problematic video viewing later on. The researchers identified daytime mood and daytime body functions as the core bridges connecting the two conditions. Students who felt mentally exhausted during the day were much more likely to report feeling anxious or restless when they could not watch videos.
The daytime consequences of bad sleep turned out to fuel a reliance on the applications. Models of psychology help explain exactly why this cycle occurs. A lack of high-quality sleep severely impairs cognitive executive functions. Executive functions are the advanced mental skills needed to control impulses and stay focused on long-term goals.
When people are tired, their ability to resist immediate rewards drops rapidly. Short videos offer quick, passive bursts of entertainment that require almost zero mental effort to consume. The applications provide a highly accessible way to regulate negative emotions or fight off boredom. Watching the fast-paced clips activates reward centers in the brain, offering temporary relief from physical fatigue.
Experiencing this relief creates a negative feedback loop. Tired individuals seek out easy stimulation during the day, which then keeps them awake later into the night. Difficulty falling asleep at the start of the night emerged as a major driving force in the symptom maps. Struggling to initiate rest often cascades into a chronic pattern of fragmented sleeping.
The researchers noted that daytime sleepiness functioned as a very specific bridge symptom. Reduced daytime wakefulness prompted students to use digital media as an artificial way to stay alert during classes or studying periods. The application algorithms then fed them an endless personalized stream. This constant feed created a trance-like state where users continually underestimated how long they had been scrolling.
Breaking this reciprocal cycle requires highly targeted strategies. The study suggests that treating specific sleep symptoms might naturally reduce problematic screen time. Cognitive behavioral therapy for insomnia is a structured program that helps people build healthier resting habits. This therapy involves sleep education, relaxation techniques, and completely restructuring a person’s bedtime routine.
Addressing the root causes of nighttime wakefulness could restore the daytime energy needed to resist digital distractions. The authors suggest other practical ways to combat the negative spiral. Spending time outdoors in natural environments can improve working memory and reduce everyday anxiety. Engaging in offline social activities with friends and family can directly alleviate feelings of isolation.
Building stronger real-world support networks improves psychological resilience. Participating in peer sports or family gatherings lessens the quiet moments of loneliness. These activities provide robust emotional regulation. Connecting with others in the physical world reduces the baseline need to turn to a personalized algorithmic feed for temporary comfort.
The study has some limitations that require consideration. All the participants were students at a single university, so the results may not apply to older adults or different demographic groups. The data relied entirely on self-reported surveys. People are not always accurate when estimating their own screen time or sleep duration.
Relying on personal memory can introduce bias into the answers. The statistical mapping model used in the study cannot definitively prove that one symptom directly causes another in all situations. It only shows that levels of one symptom predict later changes in the network. The model also does not perfectly separate long-term personality traits from temporary daily changes.
Some individuals might naturally be prone to both restless sleeping and heavy internet use because of underlying personality factors. Future research should track symptoms on a daily basis over longer periods of time. Tracking real-time usage data directly from smartphones would provide a more objective measure. These updates would help clarify exactly how exhaustion and digital media interact in the real world.
The study, “Exploring longitudinal relationships between problematic short-form video use and insomnia symptoms: A cross-lagged panel network analysis,” was authored by Xiaoqiong Li, Meng Bai, and Xueqi Yang.
URL: https://www.psypost.org/how-daylight-exhaustion-secretly-fuels-endless-nighttime-scrolling/
-------------------------------------------------
DAILY EMAIL DIGEST: Email [email protected] -- no subject or message needed.
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
NYU Information for Practice puts out 400-500 good quality health-related research posts per week but its too much for many people, so that bot is limited to just subscribers. You can read it or subscribe at @PsychResearchBot
Since 1991 The National Psychologist has focused on keeping practicing psychologists current with news, information and items of interest. Check them out for more free articles, resources, and subscription information: https://www.nationalpsychologist.com
EMAIL DAILY DIGEST OF RSS FEEDS -- SUBSCRIBE: http://subscribe-article-digests.clinicians-exchange.org
READ ONLINE: http://read-the-rss-mega-archive.clinicians-exchange.org
It's primitive... but it works... mostly...
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #SleepAndScreenTime #InsomniaSymptoms #ShortFormVideoUse #DigitalDistraction #SleepHealth #CognitiveBehavioralTherapyForInsomnia #BedtimeHabits #ScreenTimeOveruse #DigitalWellness #LateNightScrolling
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
The biological and psychological legacy of REM sleep continues to exert a significant influence on our nighttime experiences.
Why Can’t I Run in My Dreams? The Science, Psychology, and Spiritual Meaning Behind Slow-Motion Dreams. It provides a detailed, analytical overview of the forces behind these dreams, offering much-needed clarity on how the brain processes movement during rest.
Read here:
https://www.authorkennethgray.com/why-cant-i-run-in-my-dreams/#Neuroscience #DreamStudies #Psychology #PublicInterest #SleepHealth
-
Transform your bedroom into a dark sanctuary to enjoy deeper, more restorative sleep.
Follow @biohackingpathway for more
#BetterSleep #SleepHealth #Wellness #Health #Wellbeing #HealthyAgeing #EmotionalWellbeing #WellnessLifestyle #HealthAndWellbeing #WellnessGoals #Biohacking #WellnessCommunity #WellnessVibes #WellnessMatters #WellBeingJourney https://mastodon.social/@biohackingpathway/116485603490706689 -
How scientists changed their view of insomnia
#Insomnia #SleepHealth #Health #MentalHealth #Wellness #Stress #PublicHealth #Psychology #Sleep #SleepDisorder #Healthcare #CBTI #Tiredness #ChronicIllness #Lifestyle #SleepScience #Medicine #Science
https://the-14.com/how-scientists-changed-their-view-of-insomnia/ -
Why Modern Life Is Ruining Your Sleep?😴😴
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking -
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
The Secret to Muscle Gains? Sleep More 😴💪
Follow @biohackingpathway for more
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Struggling to Sleep? Spending Time in the Garden Might Help, Study Finds https://www.allforgardening.com/1680532/struggling-to-sleep-spending-time-in-the-garden-might-help-study-finds/ #AmericanAcademyOfSleepMedicine #FarihaAbbasiFeinberg #garden #gardening #JournalOfAffectiveDisorders #PhysicalActivity #SleepHealth #SleepSpecialist #SufficientSleep
-
Oof. Nearly 30 sleep apnea events per hour last night. My sleep was highly disrupted. Not sure what happened (mask seal was great) but that was painful. Hoping that was a one off and not some fundamental change.
-
The effects of Omega-3 supplementation on stress, anxiety, depression, sleep quality, and everyday memory in individuals with psychological distress: A randomized, double-blind, placebo-controlled trial - ScienceDirect
#HealthyAgeing #omega3 #anxiety #depression #memory #sleephealth #stressrelief
https://www.sciencedirect.com/science/article/pii/S0165032725024978?via%3Dihub=
-
Potentially good news for sleep apnea sufferers from the field of medicine. Participants in a clinical drug trial who took the highest daily dose of an epilepsy drug had nearly 50 percent fewer breathing interruptions while sleeping. @ScienceAlert has more:
-
Trapped by the alarm? Beat the snooze cycle and wake up feeling energised https://english.mathrubhumi.com/lifestyle/alarm-hitting-snooze-button-morning-jlw0g8fi?utm_source=dlvr.it&utm_medium=mastodon #SleepHealth #MorningRoutine #SleepScience #HealthyLifestyle
-
Rested rebels: Why sleep is the ultimate performance hack https://english.mathrubhumi.com/lifestyle/health/world-sleep-day-2026-prioritise-rest-for-mental-physical-performance-jj85vozp?utm_source=dlvr.it&utm_medium=mastodon #WorldSleepDay #SleepHealth #HealthyLifestyle #RestWell #SleepTips
-
B.C.’s switch to permanent DST adds to the ‘perfect storm’ for poorer adolescent sleep and mental health
#BritishColumbia #Canada #DaylightSavingTime #DST #SleepHealth #TeenHealth #MentalHealth #Health #CircadianRhythm #AdolescentHealth #Sleep #Sunlight
https://the-14.com/b-c-s-switch-to-permanent-dst-adds-to-the-perfect-storm-for-poorer-adolescent-sleep-and-mental-health/ -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
Naps are great, but I have to be careful.
A 20-minute power nap helps,
but a 3-hour depression-escape nap wrecks my sleep schedule.
Balance is everything. 🐨#Napping #SleepHealth #BipolarBalance #BipolarLife
Join Speaking Bipolar’s Positivity Club (Free) to live your best life now.
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Can't get a good night's rest? Here are 7 easy, science-backed changes to your evening routine that can improve sleep tonight: limit screens, cool your room, try progressive relaxation, and more. Full guide: https://example.com/sleep #SleepHealth #Wellbeing
-
Why Good Sleep Is Your Secret Weapon
Uncover the secrets to a good night's rest! We explore different sleep types (REM, deep, light) and their importance, plus how social pressures and nighttime creativity affect our sleep. Learn how to prioritize sleep for peak performance!
Follow @biohackingpathway for more
#sleepscience #sleephealth #sleephygiene #antiaging #antiage #antiagingskincare #healthyaging #nightsleep #creativity #socialpressure #podcast #wellbeing #mentalhealth #sleeptips
-
Social jetlag explained: Why your Monday mornings feel terrible https://english.mathrubhumi.com/lifestyle/social-jetlag-sleep-schedule-fix-r24zjhdt?utm_source=dlvr.it&utm_medium=mastodon #SocialJetlag #SleepHealth #Wellness #CircadianRhythm #LifestyleTips
-
Let’s Start 2026 With Ways to Boost Your Immune System Naturally
Your immune system is your body’s built-in defense network, working around the clock to protect you from illness. While there’s no magic switch to “turn on” immunity, healthy daily habits can strengthen your body’s ability to respond to threats. Below are science-backed, practical ways to boost your immune system naturally—easy to adopt and sustainable long-term.
1. Eat a Nutrient-Dense, Whole-Food Diet
Food is fuel for immune cells. Prioritize variety and color on your plate.
Immune-supporting nutrients to include:
Vitamin C: citrus fruits, strawberries, bell peppers Vitamin D: fatty fish, fortified foods, sensible sun exposure Zinc: beans, nuts, seeds, whole grains Antioxidants: leafy greens, berries, sweet potatoes
Tip: Aim for at least 5 servings of fruits and vegetables daily to cover key micronutrients.
2. Stay Physically Active
Regular, moderate exercise improves circulation, helping immune cells move efficiently through the body.
Brisk walking, cycling, swimming, or yoga Target 150 minutes per week of moderate activity Avoid overtraining—excessive intensity can temporarily suppress immunity
3. Prioritize Quality Sleep
Sleep is when your body repairs and rebalances immune function.
Adults should aim for 7–9 hours per night Keep a consistent bedtime Limit screens at least 1 hour before bed
Pro tip: Poor sleep increases inflammation and lowers infection resistance.
4. Manage Stress Effectively
Chronic stress elevates cortisol, which can weaken immune response over time.
Try:
Deep breathing or meditation (5–10 minutes daily) Journaling or gratitude practices Time outdoors or short breaks during the day
Even small stress-relief habits can make a measurable difference.
5. Stay Hydrated
Water supports every system in your body—including immunity.
Helps flush toxins Supports lymphatic circulation Aids nutrient transport
Goal: Drink water consistently throughout the day; urine should be pale yellow.
6. Support Gut HealthA large portion of your immune system lives in your gut.
Eat probiotic-rich foods: yogurt, kefir, sauerkraut, kimchi Include prebiotic fiber: oats, bananas, onions, garlic Limit ultra-processed foods and excess sugar
A healthy gut microbiome = stronger immune signaling.
7. Avoid Immune-Suppressing Habits
Reduce behaviors that weaken immune defenses:
Smoking or vaping Excess alcohol (limit to moderation) Highly processed, nutrient-poor diets
Small reductions can yield meaningful benefits.
8. Be Smart With SupplementsSupplements can help fill gaps—but they’re not substitutes for healthy habits.
Commonly used options include:
Vitamin D Vitamin C Zinc
Always consult a healthcare professional before starting new supplements, especially if you have underlying conditions.
Final ThoughtsBoosting your immune system isn’t about quick fixes—it’s about consistent, healthy choices. Eating well, sleeping enough, managing stress, and staying active work together to support your body’s natural defenses year-round.
Start small, stay consistent, and your immune system will thank you. Follow DoRaleigh.com for daily updates on government meetings, local festivals, and community happenings — your one-stop guide to everything Raleigh!
Post your community News, Events, and you can request placing a Paid ad on our Submissions Page.
Follow Us: Instagram | Facebook | BSky | Linkedin
#boostImmunityNaturally #gutHealth #HealthNews #healthyLifestyle #immuneSupport #immuneSystemHealth #News #nutritionAndImmunity #sleepHealth #stressManagement #wellnessTips
-
Use Sleep Focus and Shortcuts for automatic night vision red mode on an iPhone.
#DIY #vision #nightMode #red #monochromatic #sleepHealth #accessibilityHacks #iPhone #iOS #missingFeature
https://www.marsorange.com/posts/20251226-iphone-night-mode-red/
-
Why do we wake up shortly before our alarm goes off? It’s not by chance
-
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
The Secret to Muscle Gains? Sleep More 😴💪
Follow @biohackingpathway for more
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Need an energy boost? Just 20 minutes of rest can increase alertness by 50% and performance by 30%. NASA research shows power naps improve memory, focus, and even lower blood pressure. Best time? Between 1-3 PM. Try it today!
#powernap #nap #sleephealth #energy #productivity #wellness #health #sleep #mindfulness #selfcare