#sleephealth — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #sleephealth, aggregated by home.social.
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
😴 You slept… but still woke up tired?
What feels like “normal tiredness” may actually be your body asking for balance.
In this article, discover the real reasons behind this & practical ways to regain your energy naturally.
https://www.practo.com/healthfeed/why-are-young-indians-feeling-tired-all-the-time-68284/post
#Health #Wellness #MentalHealth #Burnout #SleepHealth #HealthyLifestyle #StressManagement #IndianLifestyle #DigitalFatigue #YoungAdults #SelfCare #Fitness #Ayurveda #PreventiveHealth #WorkLifeBalance #EnergyLevels #HealthyHabits #DrChetanDhongade
-
The biological and psychological legacy of REM sleep continues to exert a significant influence on our nighttime experiences.
Why Can’t I Run in My Dreams? The Science, Psychology, and Spiritual Meaning Behind Slow-Motion Dreams. It provides a detailed, analytical overview of the forces behind these dreams, offering much-needed clarity on how the brain processes movement during rest.
Read here:
https://www.authorkennethgray.com/why-cant-i-run-in-my-dreams/#Neuroscience #DreamStudies #Psychology #PublicInterest #SleepHealth
-
Transform your bedroom into a dark sanctuary to enjoy deeper, more restorative sleep.
Follow @biohackingpathway for more
#BetterSleep #SleepHealth #Wellness #Health #Wellbeing #HealthyAgeing #EmotionalWellbeing #WellnessLifestyle #HealthAndWellbeing #WellnessGoals #Biohacking #WellnessCommunity #WellnessVibes #WellnessMatters #WellBeingJourney https://mastodon.social/@biohackingpathway/116485603490706689 -
Transform your bedroom into a dark sanctuary to enjoy deeper, more restorative sleep.
Follow @biohackingpathway for more
#BetterSleep #SleepHealth #Wellness #Health #Wellbeing #HealthyAgeing #EmotionalWellbeing #WellnessLifestyle #HealthAndWellbeing #WellnessGoals #Biohacking #WellnessCommunity #WellnessVibes #WellnessMatters #WellBeingJourney https://mastodon.social/@biohackingpathway/116485603490706689 -
How scientists changed their view of insomnia
#Insomnia #SleepHealth #Health #MentalHealth #Wellness #Stress #PublicHealth #Psychology #Sleep #SleepDisorder #Healthcare #CBTI #Tiredness #ChronicIllness #Lifestyle #SleepScience #Medicine #Science
https://the-14.com/how-scientists-changed-their-view-of-insomnia/ -
Why Modern Life Is Ruining Your Sleep?😴😴
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking -
Why Modern Life Is Ruining Your Sleep?😴😴
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking -
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
🏋️♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,
✨Follow the link for more information on this story✨
https://www.scimex.org/newsfeed/timing-your-exercise-schedule-to-your-bodyclock-could-help-protect-your-heart#science #sciencenews #research #stem #facts #knowledge #sciencefacts #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth
-
The Secret to Muscle Gains? Sleep More 😴💪
Follow @biohackingpathway for more
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation -
The Secret to Muscle Gains? Sleep More 😴💪
Follow @biohackingpathway for more
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Struggling to Sleep? Spending Time in the Garden Might Help, Study Finds https://www.allforgardening.com/1680532/struggling-to-sleep-spending-time-in-the-garden-might-help-study-finds/ #AmericanAcademyOfSleepMedicine #FarihaAbbasiFeinberg #garden #gardening #JournalOfAffectiveDisorders #PhysicalActivity #SleepHealth #SleepSpecialist #SufficientSleep
-
Oof. Nearly 30 sleep apnea events per hour last night. My sleep was highly disrupted. Not sure what happened (mask seal was great) but that was painful. Hoping that was a one off and not some fundamental change.
-
The effects of Omega-3 supplementation on stress, anxiety, depression, sleep quality, and everyday memory in individuals with psychological distress: A randomized, double-blind, placebo-controlled trial - ScienceDirect
#HealthyAgeing #omega3 #anxiety #depression #memory #sleephealth #stressrelief
https://www.sciencedirect.com/science/article/pii/S0165032725024978?via%3Dihub=
-
Potentially good news for sleep apnea sufferers from the field of medicine. Participants in a clinical drug trial who took the highest daily dose of an epilepsy drug had nearly 50 percent fewer breathing interruptions while sleeping. @ScienceAlert has more:
-
Trapped by the alarm? Beat the snooze cycle and wake up feeling energised https://english.mathrubhumi.com/lifestyle/alarm-hitting-snooze-button-morning-jlw0g8fi?utm_source=dlvr.it&utm_medium=mastodon #SleepHealth #MorningRoutine #SleepScience #HealthyLifestyle
-
Rested rebels: Why sleep is the ultimate performance hack https://english.mathrubhumi.com/lifestyle/health/world-sleep-day-2026-prioritise-rest-for-mental-physical-performance-jj85vozp?utm_source=dlvr.it&utm_medium=mastodon #WorldSleepDay #SleepHealth #HealthyLifestyle #RestWell #SleepTips
-
Rested rebels: Why sleep is the ultimate performance hack https://english.mathrubhumi.com/lifestyle/health/world-sleep-day-2026-prioritise-rest-for-mental-physical-performance-jj85vozp?utm_source=dlvr.it&utm_medium=mastodon #WorldSleepDay #SleepHealth #HealthyLifestyle #RestWell #SleepTips
-
Rested rebels: Why sleep is the ultimate performance hack https://english.mathrubhumi.com/lifestyle/health/world-sleep-day-2026-prioritise-rest-for-mental-physical-performance-jj85vozp?utm_source=dlvr.it&utm_medium=mastodon #WorldSleepDay #SleepHealth #HealthyLifestyle #RestWell #SleepTips
-
Rested rebels: Why sleep is the ultimate performance hack https://english.mathrubhumi.com/lifestyle/health/world-sleep-day-2026-prioritise-rest-for-mental-physical-performance-jj85vozp?utm_source=dlvr.it&utm_medium=mastodon #WorldSleepDay #SleepHealth #HealthyLifestyle #RestWell #SleepTips
-
#SleepHealth #WellnessTips #HealthySleep #MindfulLiving #SleepBetter #BiohackingSecrets #WellnessJourney #HealthyAging #WellnessWarrior #EmotionalWellbeing #WellnessLifestyle #WellbeingMatters #WellnessCommunity #PhysicalWellbeing #WellnessGoals https://mastodon.social/@biohackingpathway/116207919489444508
-
B.C.’s switch to permanent DST adds to the ‘perfect storm’ for poorer adolescent sleep and mental health
#BritishColumbia #Canada #DaylightSavingTime #DST #SleepHealth #TeenHealth #MentalHealth #Health #CircadianRhythm #AdolescentHealth #Sleep #Sunlight
https://the-14.com/b-c-s-switch-to-permanent-dst-adds-to-the-perfect-storm-for-poorer-adolescent-sleep-and-mental-health/ -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
🌃 “#Sleep is often overlooked in discussions of work and health, yet it is one of the most fundamental mechanisms through which #stress translates into #disease. Our study shows that #nightwork does not affect everyone equally; it interacts with #gender roles, #education, #family responsibilities, and even #geography," says CG Co-Director Professor Melinda Mills.
Read the full story in section 9 of the latest Changing Populations:
https://sway.cloud.microsoft/WzAYgcw05ELXCdXJ?ref=Link -
New Zealand Beats Netherlands, Finland, United Kingdom, Australia, Belgium and More Countries Around The World Winning the Battle of Late Nights: But At What Cost to Your Health
Home » Latest Travel News » New Zealand Beats Netherlands, Finland, United Kingdom, Australia, Belgium and…
#Netherlands #Nederland #NL #Europe #Europa #EU #latesttravelnews #netherlands #newzealandsleep #newzealandtravelnews #Nieuws #sleephealth #sleepsurvey #uksleephabits #ustourism
https://www.europesays.com/2788232/ -
New Zealand Beats Netherlands, Finland, United Kingdom, Australia, Belgium and More Countries Around The World Winning the Battle of Late Nights: But At What Cost to Your Health https://www.byteseu.com/1810444/ #Belgium #LatestTravelNews #NewZealandSleep #NewZealandTravelNews #SleepHealth #SleepSurvey #UkSleepHabits #UsTourism
-
Naps are great, but I have to be careful.
A 20-minute power nap helps,
but a 3-hour depression-escape nap wrecks my sleep schedule.
Balance is everything. 🐨#Napping #SleepHealth #BipolarBalance #BipolarLife
Join Speaking Bipolar’s Positivity Club (Free) to live your best life now.
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Sleep Deprivation: Willpower Killer?
Discover how sleep deprivation impacts willpower and decision-making! We explore the domino effect of poor sleep on daily habits and the struggle to break bad cycles. Learn practical tips to prioritize deep sleep and improve your life!
Follow @biohackingpathway for more
#sleepdeprivation #willpower #decisionmaking #sleephealth #habits #lifestyle #wellbeing #productivity #wellnesswins #wellnessmatters #holisticwellbeing #mentalhealth #selfimprovement
-
Can't get a good night's rest? Here are 7 easy, science-backed changes to your evening routine that can improve sleep tonight: limit screens, cool your room, try progressive relaxation, and more. Full guide: https://example.com/sleep #SleepHealth #Wellbeing
-
Why Good Sleep Is Your Secret Weapon
Uncover the secrets to a good night's rest! We explore different sleep types (REM, deep, light) and their importance, plus how social pressures and nighttime creativity affect our sleep. Learn how to prioritize sleep for peak performance!
Follow @biohackingpathway for more
#sleepscience #sleephealth #sleephygiene #antiaging #antiage #antiagingskincare #healthyaging #nightsleep #creativity #socialpressure #podcast #wellbeing #mentalhealth #sleeptips