#circadianrhythm — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #circadianrhythm, aggregated by home.social.
-
While organizing my office, I came across this book 😮
At one point in my scientific career, I had hoped to use Chlamydomonas in my research 😏
It looks like that won’t be happening after all, but I’ll still keep these books in my office. They look pretty 😊#Science #Algae #Timeless #CircadianRhythm #Book #Photography
-
#CircadianRhythm #TimeRestrictedFeeding #FeedingTimes #InternalClock #BodyClock #HealthPodcast #SciencePodcast #Wellness #healthyageing #healthyaging #wellnessthatworks #wellnessblogger #wellnesslifestyle #wellnesswarrior #healthandwellbeing #wellnessgoals #Sleep https://mastodon.social/@biohackingpathway/116502590835877346
-
#CircadianRhythm #TimeRestrictedFeeding #FeedingTimes #InternalClock #BodyClock #HealthPodcast #SciencePodcast #Wellness #healthyageing #healthyaging #wellnessthatworks #wellnessblogger #wellnesslifestyle #wellnesswarrior #healthandwellbeing #wellnessgoals #Sleep https://mastodon.social/@biohackingpathway/116502590835877346
-
Night light disrupts antibody production rhythms, may raise risk of death, Israeli study finds
Artificial lighting from sources as common as streetlights may disrupt the circadian rhythms and immune systems of mammals,…
#Israel #News #academic-research #circadianrhythm #mice #telaviv #TelAvivUniversity #wildanimals #zoology
https://www.europesays.com/2950700/ -
One simple shift in your morning routine can improve your sleep and energize you all day
-
One simple shift in your morning routine can improve your sleep and energize you all day
-
One simple shift in your morning routine can improve your sleep and energize you all day
-
One simple shift in your morning routine can improve your sleep and energize you all day
-
https://www.europesays.com/iran/85916/ Night light disrupts antibody production rhythms, may raise risk of death, Israeli study finds #AcademicResearch #CircadianRhythm #Israel #mice #TelAvivUniversity #WildAnimals #zoology
-
Why Modern Life Is Ruining Your Sleep?😴😴
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking -
We Don’t Have a Mental Health Crisis—We Have a Disconnection Crisis
Rising anxiety and burnout are often treated as individual problems, but what if they are signals of something larger? This article explores how modern life has drifted out of alignment with human rhythms, relationships, and cycles—and why reconnecting with those foundations may be as important as treating symptoms. -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
"Does waking up to morning sunlight boost your energy 30%?
Morning sunlight exposure sets our internal clock, regulating the circadian rhythm. This helps increase alertness, energy, and overall well-being.
As Mark Twain said, "The best way to cheer yourself up is to try to cheer somebody else up."
Can you wake up before your alarm and still manage to shine with sunlight exposure? #CircadianRhythm #Wellbeing #MorningSunlight"
-
Stop the 3 AM ceiling stares! 😴 Our internal clocks shift as we age, but syncing with the sun's rhythm can reset your sleep. ☀️ Reclaim your rest and flow.
🌼 join us at breathebloom.co
#GenXWomen #CircadianRhythm #SleepTips #RhythmicHealth #MidlifeWellness
-
https://www.europesays.com/ie/380603/ Eating earlier in the day is linked to lower nighttime glucose in gestational diabetes #blood #BloodSugar #breakfast #Carbohydrate #CircadianRhythm #diabetes #Eclampsia #Éire #Exercise #GestationalDiabetes #Glucose #Health #IE #Insulin #Ireland #MealTiming #Metabolism #PreEclampsia #Pregnancy #Research
-
B.C.’s switch to permanent DST adds to the ‘perfect storm’ for poorer adolescent sleep and mental health
#BritishColumbia #Canada #DaylightSavingTime #DST #SleepHealth #TeenHealth #MentalHealth #Health #CircadianRhythm #AdolescentHealth #Sleep #Sunlight
https://the-14.com/b-c-s-switch-to-permanent-dst-adds-to-the-perfect-storm-for-poorer-adolescent-sleep-and-mental-health/ -
Fitness coach with 18 years of experience shares 6 hacks to improve quality of sleep: ‘Stop staring into your phone at…’
If falling asleep has started to feel like a nightly battle, you’re not alone. For many people, lying…
#NewsBeep #News #Fitness #AU #Australia #circadianrhythm #coolertemperature #exposuretosunlight #Health #lifestyletweaks #melatoninproduction #sleepquality
https://www.newsbeep.com/au/530460/ -
Interesting (but controversial in the HN comments 😬):
“Blue Light Filters Don’t Work”, Patrick Mineault, NeuroAI (https://www.neuroai.science/p/blue-light-filters-dont-work).
Via HN: https://news.ycombinator.com/item?id=47091606
#Sleep #Health #Brain #CircadianRhythm #BlueLight #NightShift #DarkMode #Light #Eyes
-
My brain needs signals to know when to be awake.
I’m soaking up morning light to set my internal clock.
Sun up = Mood up. ☀️ -
https://reviewengine.in/gadget-reviews/wearables/oura-ring-alternative-review.html
It’s comfortable to wear, accurately tracks #sleep and #recovery and offers a generous amount of data without locking anything behind a subscription. A new charging case, slightly slimmer design and added #circadianrhythm features all help it feel like a step up over the original version.#OuraRing #SmartRing #HealthTech #Wearables
https://reviewengine.in/gadget-reviews/wearables/oura-ring-alternative-review.html -
Sleep expert's animal 'chronotype' quiz is deeply insightful for understanding our sleep patterns
https://fed.brid.gy/r/https://www.upworthy.com/expert-sleep-quiz-for-chrontype
-
Social jetlag explained: Why your Monday mornings feel terrible https://english.mathrubhumi.com/lifestyle/social-jetlag-sleep-schedule-fix-r24zjhdt?utm_source=dlvr.it&utm_medium=mastodon #SocialJetlag #SleepHealth #Wellness #CircadianRhythm #LifestyleTips
-
Photoperiodism (Zoology 🦥)
Photoperiod is the change of day length over the seasons. Earth's rotation around its axis produces 24-hour changes in light and dark cycles on Earth. The length of the light and dark in each phase varies across the seasons due to the axial tilt of Earth. The photoperiod defines the length of the light. For example, in summer the lengt...
https://en.wikipedia.org/wiki/Photoperiodism
#Photoperiodism #Botany #Zoology #CircadianRhythm #PlantPhysiology #AnimalPhysiology
-
Thanks a lot, #CircadianRhythm! How am I supposed to get at least six hours of sleep, if I wake up at the usual time?! 🤬
-
Can’t sleep your way to energy? Here’s how to beat constant tiredness https://english.mathrubhumi.com/lifestyle/health/sleep-consistency-quality-timing-mafsbs73?utm_source=dlvr.it&utm_medium=mastodon #SleepTips #HealthySleep #SleepRoutine #CircadianRhythm #Wellbeing
-
Can’t sleep your way to energy? Here’s how to beat constant tiredness https://english.mathrubhumi.com/lifestyle/health/sleep-consistency-quality-timing-mafsbs73?utm_source=dlvr.it&utm_medium=mastodon #SleepTips #HealthySleep #SleepRoutine #CircadianRhythm #Wellbeing
-
Can’t sleep your way to energy? Here’s how to beat constant tiredness https://english.mathrubhumi.com/lifestyle/health/sleep-consistency-quality-timing-mafsbs73?utm_source=dlvr.it&utm_medium=mastodon #SleepTips #HealthySleep #SleepRoutine #CircadianRhythm #Wellbeing
-
Can’t sleep your way to energy? Here’s how to beat constant tiredness https://english.mathrubhumi.com/lifestyle/health/sleep-consistency-quality-timing-mafsbs73?utm_source=dlvr.it&utm_medium=mastodon #SleepTips #HealthySleep #SleepRoutine #CircadianRhythm #Wellbeing
-
Can’t sleep your way to energy? Here’s how to beat constant tiredness https://english.mathrubhumi.com/lifestyle/health/sleep-consistency-quality-timing-mafsbs73?utm_source=dlvr.it&utm_medium=mastodon #SleepTips #HealthySleep #SleepRoutine #CircadianRhythm #Wellbeing
-
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
Why do we wake up shortly before our alarm goes off? It’s not by chance
#Science #Physiology #Sleep #SleepScience #BodyClock #SleepHealth #HumanBiology #SleepCycles #Neuroscience #HealthySleep #MorningRoutine #ScienceExplained #The14
#CircadianRhythm
https://the-14.com/why-do-we-wake-up-shortly-before-our-alarm-goes-off-its-not-by-chance/ -
How to optimize your circadian rhythm – Life Kit – NPR
How to optimize your circadian rhythm
December 4, 20253:05 AM ET, 15-Minute Listen
Tips to tune up your body’s internal clock.
There’s research showing that too much light at night and not enough daylight is taking years off our lives. NPR health correspondent Will Stone has tips to tune up your body’s internal clock. This episode originally published December 17, 2024.
Follow us on Instagram: @nprlifekit
Sign up for our newsletter here.
Have an episode idea or feedback you want to share? Email us at [email protected]
Support the show and listen to it sponsor-free by signing up for Life Kit+ at plus.npr.org/lifekitContinue/Read Original Article Here: How to optimize your circadian rhythm : Life Kit : NPR
#CircadianRhythm #December172024 #Health #HumanBody #InternalClock #LifeKit #LightAtNight #NationalPublicRadio #NPR #Optimize
-
How to optimize your circadian rhythm – Life Kit – NPR
How to optimize your circadian rhythm
December 4, 20253:05 AM ET, 15-Minute Listen
Tips to tune up your body’s internal clock.
There’s research showing that too much light at night and not enough daylight is taking years off our lives. NPR health correspondent Will Stone has tips to tune up your body’s internal clock. This episode originally published December 17, 2024.
Follow us on Instagram: @nprlifekit
Sign up for our newsletter here.
Have an episode idea or feedback you want to share? Email us at [email protected]
Support the show and listen to it sponsor-free by signing up for Life Kit+ at plus.npr.org/lifekitContinue/Read Original Article Here: How to optimize your circadian rhythm : Life Kit : NPR
#CircadianRhythm #December172024 #Health #HumanBody #InternalClock #LifeKit #LightAtNight #NationalPublicRadio #NPR #Optimize
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
https://www.europesays.com/uk/615320/ Study reveals night-time habit that can improve heart health and reduce blood pressure | #BloodPressure #CircadianRhythm #ConsistentBedtime #Health #HeartHealth #Hypertension #ImproveSleepQuality #SleepConsistency #SleepRoutine #UK #UnitedKingdom
-
Some people say that I shouldn't force myself to sleep if I am not sleepy, and the most prominent proof is that I have tried to sleep many times but cannot. Maybe my body is smart enough to detect that it's not time to sleep yet, due to energy levels and so on. I don't know. Correct me if I am wrong.
#SleepScience #SleepHygiene #CircadianRhythm #Insomnia #Rest #MentalHealth #BodyAwareness #SelfCare #Health #ITLife #Neurodiversity #Anxiety #SleepTips #Wellbeing #Logic
-
Some people say that I shouldn't force myself to sleep if I am not sleepy, and the most prominent proof is that I have tried to sleep many times but cannot. Maybe my body is smart enough to detect that it's not time to sleep yet, due to energy levels and so on. I don't know. Correct me if I am wrong.
#SleepScience #SleepHygiene #CircadianRhythm #Insomnia #Rest #MentalHealth #BodyAwareness #SelfCare #Health #ITLife #Neurodiversity #Anxiety #SleepTips #Wellbeing #Logic
-
Some people say that I shouldn't force myself to sleep if I am not sleepy, and the most prominent proof is that I have tried to sleep many times but cannot. Maybe my body is smart enough to detect that it's not time to sleep yet, due to energy levels and so on. I don't know. Correct me if I am wrong.
#SleepScience #SleepHygiene #CircadianRhythm #Insomnia #Rest #MentalHealth #BodyAwareness #SelfCare #Health #ITLife #Neurodiversity #Anxiety #SleepTips #Wellbeing #Logic
-
Some people say that I shouldn't force myself to sleep if I am not sleepy, and the most prominent proof is that I have tried to sleep many times but cannot. Maybe my body is smart enough to detect that it's not time to sleep yet, due to energy levels and so on. I don't know. Correct me if I am wrong.
#SleepScience #SleepHygiene #CircadianRhythm #Insomnia #Rest #MentalHealth #BodyAwareness #SelfCare #Health #ITLife #Neurodiversity #Anxiety #SleepTips #Wellbeing #Logic
-
Just wondering...
#NotJustSad people: Do you have a time of day when you typically feel worse?
-
There's a growing discussion about reverting Peninsular Malaysia's time zone to GMT+7, which reflects the sun's natural position. The current GMT+8, adopted to follow Sabah and Sarawak, creates an unnatural body clock (circadian rhythm) conflict with very late sunrises. As someone from Sabah, I feel the difference acutely—our time feels natural, but the Peninsular's time is jarring.
https://weblog.kalvin.my/the-gmt-8-time-zone-dilemma-peninsular-versus-sabahs-sunrise/
#malaysia #timezone #gmt8 #gmt7 #sabah #peninsular #bodyclock #circadianrhythm #sunrise #sleephealth #geography #nationalunity #debate #lifestyle #malaysian
-
Kaye Kittrell: Catching Up (health stuff, circadian rhythm, new seating area) https://www.allforgardening.com/1492061/kaye-kittrell-catching-up-health-stuff-circadian-rhythm-new-seating-area/ #CatchingUpWithKaye #CircadianRhythm #CountryLiving #EmptyNester #flowers #gardening #green #grounding #GrowYourOwn #GrowYourOwnFood #GrowYourOwnVegetables #homesteading #KayeKittrell #LateBloomer #LateBloomerShow #LateBloomerUrbanOrganicGardenShow #organic #RainCapture #StartingOver #sustainability #SustainableHomestead #Tennessee #TennesseeGardening #TennesseeHomestead #VLog
-
Why does putting back the clocks an hour disrupt us so much?
#Health #Science #DaylightSaving #SleepDisruption #Time #CircadianRhythm #Melatonin #Cortisol #SleepHealth #Light #Autumn #Sleep #BodyClock #TimeChange #Wellness #Biology #Menopause
https://the-14.com/why-does-putting-back-the-clocks-an-hour-disrupt-us-so-much/ -
Humans have an internal lunar clock – but light pollution is disrupting it
#Science #Moon #LunarClock #LightPollution #Moonlight #Health #HumanBiology #SleepScience #CircadianRhythm #Nature #Wildlife #ClimateChange #Animals #ArtificialLight #Menopause
https://the-14.com/humans-have-an-internal-lunar-clock-but-light-pollution-is-disrupting-it/ -
#Vögel zwitschern im #Lichtsmog fast eine Stunde länger – weltweit! 🌍🔦
Eine Analyse von 60 Mio. Tonaufnahmen zeigt, dass künstliches Licht bei 583 #Vogelarten den natürlichen Tag-Nacht-Rhythmus stört.
Besonders betroffen sind Arten mit großen Augen, offenen Nestern oder Zugverhalten. Was harmlos klingt, kann Stress, Verwirrung oder sogar Fortpflanzungsprobleme bedeuten.🐦
https://doi.org/10.1126/science.adv9472
#Vögel #Biodiversität #Naturschutz #KünstlichesLicht #CircadianRhythm #Umweltforschung