#sleepdisorders — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #sleepdisorders, aggregated by home.social.
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
DATE: July 6, 2026 at 08:00AM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: People with migraines experience restless legs syndrome at twice the normal rate
About one in five people who suffer from migraines also experience restless legs syndrome, roughly double the prevalence observed in the general public. This elevated frequency is highly pronounced among patients who endure chronic head pain or migraines accompanied by visual auras. The meta-analysis detailing these patterns was published in the Journal of Sleep Research.
Migraine is a neurological disorder characterized by recurrent attacks of throbbing head pain, often alongside nausea and extreme sensitivity to light or sound. Restless legs syndrome is a sensorimotor condition defined by an overwhelming urge to move the lower limbs. Patients typically experience uncomfortable crawling or aching sensations that worsen during periods of rest, particularly at night, and find temporary relief only through physical movement.
Medical professionals have noted that these two distinct conditions frequently appear in the same patients. To better understand this overlap, Simona Raimo, a researcher at the Magna Graecia University of Catanzaro in Italy, led a team to investigate the exact prevalence and clinical factors uniting the two disorders. The researchers aimed to aggregate existing data to offer distinct clinical guidance on how to manage patients facing both ailments simultaneously.
Single medical studies often involve a restricted number of participants, which can severely limit the statistical reliability of their conclusions. To overcome this hurdle, the researchers conducted a meta-analysis, a statistical technique that pools data from multiple independent studies to reveal broader patterns. Raimo and her team eventually isolated 30 high-quality studies published previously.
In total, the aggregated data encompassed 20,781 adult participants who had been diagnosed with migraines. Within this massive sample, 3,343 individuals also carried a full diagnosis of restless legs syndrome. By combining the available hospital data, the researchers calculated an overall pooled prevalence of 20 percent. For context, restless legs syndrome affects roughly 5 to 10 percent of the general population.
The researchers also looked at demographic traits to see if specific populations were at higher risk. Advancing age emerged as a consistent factor across the reviewed studies. Older adults naturally experience gradual changes in their dopamine production and iron metabolism, potentially explaining the higher rate of the sleep disorder in older age brackets. Although migraines are generally more common in women, sex did not produce statistically significant differences regarding the co-occurrence of the two conditions.
The specific type of migraine a patient experiences plays a major role in their overall risk profile. Migraine with aura involves sensory disturbances, such as seeing flashing lights or experiencing blind spots, that precede the onset of actual head pain. The researchers found an elevated association between restless legs syndrome and both chronic migraines and migraines with aura.
Conversely, no association was found for individuals who experience episodic migraines without an accompanying aura. The researchers suggest that as migraines become more frequent and progress into a chronic state, the physical signs of the sleep disorder become more apparent. The disease chronification process may amplify shared neurophysiological pathways in the human nervous system.
This progression aligns with a medical concept known as central sensitization. When the brain and spinal cord receive constant pain signals over many years, the nervous system can become hyper-reactive. Normal sensory inputs are suddenly processed as painful or intensely uncomfortable sensations. The researchers propose that chronic sensory input from frequent headaches, combined with the sensory dysregulation of restless legs, amplifies this heightened state of physiological alert.
Beyond clinical diagnoses, behavioral symptoms heavily influenced the co-occurrence of these conditions. Patients coping with both ailments were much more likely to report severe depressive symptoms, higher overall pain intensity, and poor sleep quality compared to those with migraines alone. Symptoms of anxiety did not reach a statistically significant association, suggesting the emotional burden leans more heavily toward depression than physical hyperarousal.
Sleep disturbances play a particularly destructive role in this dual cycle. Restless legs syndrome often involves involuntary muscle twitches that occur during actual sleep. These sudden movements produce tiny nervous system awakenings, known as micro-arousals, that prevent a person from reaching deep, restorative stages of rest. Severe sleep deprivation is a well-documented trigger for intense migraines, which creates a negative feedback loop where poor sleep generates physical pain, and physical pain disrupts rest.
The exact biological mechanisms linking migraines and restless legs syndrome remain an active area of widespread scientific investigation. One major leading theory involves the brain’s dopaminergic system. Dopamine is a chemical messenger that helps the nervous system regulate physical movement, human mood, and sensory processing.
In restless legs syndrome, abnormalities in specific dopamine pathways alter sensory processing in the spinal cord and cortex, resulting in nocturnal restlessness. In individuals with migraines, there is modern medical evidence that the brain becomes highly sensitive to dopamine. This heightened sensitivity can trigger physical symptoms like frequent yawning, intense nausea, and gastrointestinal issues just before a headache episode takes hold.
Iron regulation provides another potential biological overlap. Iron is a necessary molecular element for the human brain to synthesize dopamine properly. Patients with restless legs syndrome frequently exhibit iron deficiencies in the central nervous system, while individuals with frequent migraines often show abnormal iron accumulation in specific deep brain regions.
Recognizing this medical overlap has immediate implications for patient treatment, primarily because commonly prescribed medications can cause adverse physical interactions. Doctors frequently prescribe specific antidepressants or anti-nausea drugs to help patients manage migraine symptoms. Some of these pharmaceuticals can inadvertently trigger or exacerbate the uncomfortable physical sensations associated with restless legs syndrome.
The reverse medical reaction is also true in many hospital settings. Dopamine agonists are a specific class of drugs standardly used to calm limb movements in patients with movement disorders. If given to someone with a history of migraines, these same medications can provoke severe headache episodes. The researchers suggest that clinicians screen migraine patients for sleep disorders before finalizing a pharmaceutical protocol.
If a patient suffers from both conditions, doctors may need to pivot to alternative medications, such as specific anticonvulsant drugs, that can simultaneously soothe irritated nerves without aggravating either disorder. The study authors also advise non-pharmacological interventions, including strict sleep hygiene protocols, psychological therapies, and regular physical exercise. These lifestyle modifications can improve sleep efficiency and lift depressive symptoms without the risk of dangerous drug interactions.
The researchers outlined a few limitations in the available clinical data. The 30 studies utilized varying diagnostic questionnaires to identify sleep disorders, which introduced a high degree of statistical heterogeneity into the final results. Very few past studies have categorized patients using the most updated international criteria for headache disorders.
Future research should incorporate modern imaging techniques to observe the brains of patients experiencing both conditions simultaneously. Tracking iron levels, dopamine receptor activity, and the brain’s electrical excitability over a longer time horizon could isolate the precise biological origin point of this overlap. By tracking these variables over several years, scientists hope to develop targeted therapies that soothe the nervous system entirely.
The study, “Migraine and Restless Legs Syndrome: A Meta-Analysis,” was authored by Florindo d’Onofrio, Maria Cropano, Giada Panzino, Mariachiara Gaita, Giulio Cicarelli, Piero Barbanti, Gerardo Casucci, Simona Raimo, and Antonio Costanzo.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #MigraineAndRestlessLegs #MigrainesWithAura #RestlessLegsSyndrome #SleepDisorders #ChronicMigraine #DAdopamine #IronMetabolism #SleepHygiene #MentalHealthAwareness #NeuroScienceResearch
-
DATE: July 6, 2026 at 08:00AM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: People with migraines experience restless legs syndrome at twice the normal rate
About one in five people who suffer from migraines also experience restless legs syndrome, roughly double the prevalence observed in the general public. This elevated frequency is highly pronounced among patients who endure chronic head pain or migraines accompanied by visual auras. The meta-analysis detailing these patterns was published in the Journal of Sleep Research.
Migraine is a neurological disorder characterized by recurrent attacks of throbbing head pain, often alongside nausea and extreme sensitivity to light or sound. Restless legs syndrome is a sensorimotor condition defined by an overwhelming urge to move the lower limbs. Patients typically experience uncomfortable crawling or aching sensations that worsen during periods of rest, particularly at night, and find temporary relief only through physical movement.
Medical professionals have noted that these two distinct conditions frequently appear in the same patients. To better understand this overlap, Simona Raimo, a researcher at the Magna Graecia University of Catanzaro in Italy, led a team to investigate the exact prevalence and clinical factors uniting the two disorders. The researchers aimed to aggregate existing data to offer distinct clinical guidance on how to manage patients facing both ailments simultaneously.
Single medical studies often involve a restricted number of participants, which can severely limit the statistical reliability of their conclusions. To overcome this hurdle, the researchers conducted a meta-analysis, a statistical technique that pools data from multiple independent studies to reveal broader patterns. Raimo and her team eventually isolated 30 high-quality studies published previously.
In total, the aggregated data encompassed 20,781 adult participants who had been diagnosed with migraines. Within this massive sample, 3,343 individuals also carried a full diagnosis of restless legs syndrome. By combining the available hospital data, the researchers calculated an overall pooled prevalence of 20 percent. For context, restless legs syndrome affects roughly 5 to 10 percent of the general population.
The researchers also looked at demographic traits to see if specific populations were at higher risk. Advancing age emerged as a consistent factor across the reviewed studies. Older adults naturally experience gradual changes in their dopamine production and iron metabolism, potentially explaining the higher rate of the sleep disorder in older age brackets. Although migraines are generally more common in women, sex did not produce statistically significant differences regarding the co-occurrence of the two conditions.
The specific type of migraine a patient experiences plays a major role in their overall risk profile. Migraine with aura involves sensory disturbances, such as seeing flashing lights or experiencing blind spots, that precede the onset of actual head pain. The researchers found an elevated association between restless legs syndrome and both chronic migraines and migraines with aura.
Conversely, no association was found for individuals who experience episodic migraines without an accompanying aura. The researchers suggest that as migraines become more frequent and progress into a chronic state, the physical signs of the sleep disorder become more apparent. The disease chronification process may amplify shared neurophysiological pathways in the human nervous system.
This progression aligns with a medical concept known as central sensitization. When the brain and spinal cord receive constant pain signals over many years, the nervous system can become hyper-reactive. Normal sensory inputs are suddenly processed as painful or intensely uncomfortable sensations. The researchers propose that chronic sensory input from frequent headaches, combined with the sensory dysregulation of restless legs, amplifies this heightened state of physiological alert.
Beyond clinical diagnoses, behavioral symptoms heavily influenced the co-occurrence of these conditions. Patients coping with both ailments were much more likely to report severe depressive symptoms, higher overall pain intensity, and poor sleep quality compared to those with migraines alone. Symptoms of anxiety did not reach a statistically significant association, suggesting the emotional burden leans more heavily toward depression than physical hyperarousal.
Sleep disturbances play a particularly destructive role in this dual cycle. Restless legs syndrome often involves involuntary muscle twitches that occur during actual sleep. These sudden movements produce tiny nervous system awakenings, known as micro-arousals, that prevent a person from reaching deep, restorative stages of rest. Severe sleep deprivation is a well-documented trigger for intense migraines, which creates a negative feedback loop where poor sleep generates physical pain, and physical pain disrupts rest.
The exact biological mechanisms linking migraines and restless legs syndrome remain an active area of widespread scientific investigation. One major leading theory involves the brain’s dopaminergic system. Dopamine is a chemical messenger that helps the nervous system regulate physical movement, human mood, and sensory processing.
In restless legs syndrome, abnormalities in specific dopamine pathways alter sensory processing in the spinal cord and cortex, resulting in nocturnal restlessness. In individuals with migraines, there is modern medical evidence that the brain becomes highly sensitive to dopamine. This heightened sensitivity can trigger physical symptoms like frequent yawning, intense nausea, and gastrointestinal issues just before a headache episode takes hold.
Iron regulation provides another potential biological overlap. Iron is a necessary molecular element for the human brain to synthesize dopamine properly. Patients with restless legs syndrome frequently exhibit iron deficiencies in the central nervous system, while individuals with frequent migraines often show abnormal iron accumulation in specific deep brain regions.
Recognizing this medical overlap has immediate implications for patient treatment, primarily because commonly prescribed medications can cause adverse physical interactions. Doctors frequently prescribe specific antidepressants or anti-nausea drugs to help patients manage migraine symptoms. Some of these pharmaceuticals can inadvertently trigger or exacerbate the uncomfortable physical sensations associated with restless legs syndrome.
The reverse medical reaction is also true in many hospital settings. Dopamine agonists are a specific class of drugs standardly used to calm limb movements in patients with movement disorders. If given to someone with a history of migraines, these same medications can provoke severe headache episodes. The researchers suggest that clinicians screen migraine patients for sleep disorders before finalizing a pharmaceutical protocol.
If a patient suffers from both conditions, doctors may need to pivot to alternative medications, such as specific anticonvulsant drugs, that can simultaneously soothe irritated nerves without aggravating either disorder. The study authors also advise non-pharmacological interventions, including strict sleep hygiene protocols, psychological therapies, and regular physical exercise. These lifestyle modifications can improve sleep efficiency and lift depressive symptoms without the risk of dangerous drug interactions.
The researchers outlined a few limitations in the available clinical data. The 30 studies utilized varying diagnostic questionnaires to identify sleep disorders, which introduced a high degree of statistical heterogeneity into the final results. Very few past studies have categorized patients using the most updated international criteria for headache disorders.
Future research should incorporate modern imaging techniques to observe the brains of patients experiencing both conditions simultaneously. Tracking iron levels, dopamine receptor activity, and the brain’s electrical excitability over a longer time horizon could isolate the precise biological origin point of this overlap. By tracking these variables over several years, scientists hope to develop targeted therapies that soothe the nervous system entirely.
The study, “Migraine and Restless Legs Syndrome: A Meta-Analysis,” was authored by Florindo d’Onofrio, Maria Cropano, Giada Panzino, Mariachiara Gaita, Giulio Cicarelli, Piero Barbanti, Gerardo Casucci, Simona Raimo, and Antonio Costanzo.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #MigraineAndRestlessLegs #MigrainesWithAura #RestlessLegsSyndrome #SleepDisorders #ChronicMigraine #DAdopamine #IronMetabolism #SleepHygiene #MentalHealthAwareness #NeuroScienceResearch
-
Many people wake feeling groggy after a night of vivid dreams, but it’s not the dreaming that’s draining your energy. https://english.mathrubhumi.com/lifestyle/dreams-and-morning-fatigue-explained-xfm6fk2u?utm_source=dlvr.it&utm_medium=mastodon #Dreams #Sleep #MentalHealth #SleepDisorders
-
I've found that using Valerian root for those 3-4 hours of remaining sleep puts me into a deeper sleep and I am actually semi-rested the next day, instead of coffee filled zombie.
-
Sleep Disturbances Signal Potential Dementia Risk
Experts say bad sleep, like insomnia or daytime sleepiness, can be an early sign of dementia. Learn why sleep matters for brain health.
#SleepAndDementia, #AlzheimersAwareness, #BrainHealth, #SleepDisorders, #DementiaRisk
-
New research shows that poor sleep quality is linked to brain changes seen in dementia. About 15% of older adults with worse sleep developed dementia.
#SleepAndDementia, #AlzheimersAwareness, #BrainHealth, #SleepDisorders, #DementiaRisk
https://newsletter.tf/poor-sleep-early-dementia-signs/ -
📄 In #JCPPA: Genetic and environmental influences on sleep quality, ability to settle, and crying duration in 2‐ and 5‐month‐old infants: A longitudinal twin study
👉 https://doi.org/10.1002/jcv2.70023
#MentalHealthResearch #Autism #SleepDisorders -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
“We know in the period after you're active and get exercise, you can focus and make fewer errors.”
👉 Watch on ACAMH Learn · Free CPD/CME
#ChildMentalHealth #EvidenceBased #ADHD #SleepDisorders -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Pretty much explains why cats moving around at 3 am = exhausted 😹
How the #Brain Moves From Waking Life to #Sleep (and Back Again) | Quanta Magazine https://www.quantamagazine.org/how-the-brain-moves-from-waking-life-to-sleep-and-back-again-20251017/
#REM #Dali #creativity #lucidreaming #hypnagogic #insomnia #sleepdisorders
-
Pretty much explains why cats moving around at 3 am = exhausted 😹
How the #Brain Moves From Waking Life to #Sleep (and Back Again) | Quanta Magazine https://www.quantamagazine.org/how-the-brain-moves-from-waking-life-to-sleep-and-back-again-20251017/
#REM #Dali #creativity #lucidreaming #hypnagogic #insomnia #sleepdisorders
-
Cincinnati Reds playoff games are late. How to survive them https://www.rawchili.com/mlb/364414/ #Angeles #Baseball #bengals #Cincinnati #CincinnatiBengals #CincinnatiReds #CincinnatiReds #Disorders #Dodgers #Hub #Los #LosAngelesDodgers #MLB #National #NationalSports #Negative #NFL #NFLHub #OH #Overall #OverallNegative #Reds #sleep #SleepDisorders #Sports
-
(I did not make, stolen from the Non24 discord server)
#ActuallyAutistic #Non24 #non24sleepwakedisorder #nightowl #sleep #SleepDisorders #meme #graveyardshift #night #morning #noise #NoisePollution #sleepcycle
-
(I did not make, stolen from the Non24 discord server)
#ActuallyAutistic #Non24 #non24sleepwakedisorder #nightowl #sleep #SleepDisorders #meme #graveyardshift #night #morning #noise #NoisePollution #sleepcycle
-
Experts question viral TikTok trend of magnesium lotion for better sleep
NEWYou can now listen to Fox News articles! Magnesium is an essential mineral that supports many basic bodily functions. It is important for a healthy heart, nerves, …
#dining #cooking #diet #food #Nutrition #beautyandskin #health #Lifestyle #nutrition #restlesslegssyndrome #sleepdisorders #vitaminssupplements
https://www.diningandcooking.com/2306987/experts-question-viral-tiktok-trend-of-magnesium-lotion-for-better-sleep/ -
Experts question viral TikTok trend of magnesium lotion for better sleep
NEWYou can now listen to Fox News articles! Magnesium is an essential mineral that supports many basic bodily functions. It is important for a healthy heart, nerves, …
#dining #cooking #diet #food #Nutrition #beautyandskin #health #Lifestyle #nutrition #restlesslegssyndrome #sleepdisorders #vitaminssupplements
https://www.diningandcooking.com/2306987/experts-question-viral-tiktok-trend-of-magnesium-lotion-for-better-sleep/ -
Experts question viral TikTok trend of magnesium lotion for better sleep https://www.diningandcooking.com/2306987/experts-question-viral-tiktok-trend-of-magnesium-lotion-for-better-sleep/ #BeautyAndSkin #health #Lifestyle #nutrition #RestlessLegsSyndrome #SleepDisorders #VitaminsSupplements
-
Experts question viral TikTok trend of magnesium lotion for better sleep https://www.diningandcooking.com/2306987/experts-question-viral-tiktok-trend-of-magnesium-lotion-for-better-sleep/ #BeautyAndSkin #health #Lifestyle #nutrition #RestlessLegsSyndrome #SleepDisorders #VitaminsSupplements
-
😴 Scientists from our University and Haute École d'Ingénierie et de Gestion du Canton de Vaud (HEIG-VD), working in partnership with the City of Yverdon-les-Bains, have analyzed the sleep quality of a sample of the city’s residents. They discovered that sleep disorders are much more common there than elsewhere in the country. Additional study participants in the coming years will flesh out these findings.
Find our more: https://go.epfl.ch/673907
-
😴 Scientists from our University and Haute École d'Ingénierie et de Gestion du Canton de Vaud (HEIG-VD), working in partnership with the City of Yverdon-les-Bains, have analyzed the sleep quality of a sample of the city’s residents. They discovered that sleep disorders are much more common there than elsewhere in the country. Additional study participants in the coming years will flesh out these findings.
Find our more: https://go.epfl.ch/673907
-
New sleep supplement with no melatonin had 28k-person waitlist
Desperate for sleep? You’re not alone. The sleep supplement market is booming, with an estimated $7.6 billion in revenue last year — and it’s only growing larger. But even with countless …
#dining #cooking #diet #food #Nutrition #health #healthandwellnessproducts #nutrition #sleep #sleepdisorders #sleeptips #supplements #wellness
https://www.diningandcooking.com/2243551/new-sleep-supplement-with-no-melatonin-had-28k-person-waitlist/ -
New sleep supplement with no melatonin had 28k-person waitlist https://www.diningandcooking.com/2243551/new-sleep-supplement-with-no-melatonin-had-28k-person-waitlist/ #health #HealthAndWellnessProducts #nutrition #sleep #SleepDisorders #SleepTips #supplements #wellness
-
New sleep supplement with no melatonin had 28k-person waitlist https://www.diningandcooking.com/2243551/new-sleep-supplement-with-no-melatonin-had-28k-person-waitlist/ #health #HealthAndWellnessProducts #nutrition #sleep #SleepDisorders #SleepTips #supplements #wellness
-
I’ve barely slept all week, but slept so much today that my cat is looking jealously at me. #Non24 #SleepDisorders
-
I’ve barely slept all week, but slept so much today that my cat is looking jealously at me. #Non24 #SleepDisorders
-
I find that as I’ve gotten older, sleep has become more elusive to me. I used to be able to sleep as long as 12 hours with minimal interruption.... In fact, until I was about in my 40s, “breakfast” was not even in my vocabulary. #KnowMore #SomethingLikeLife #sleeping #sleepdisorders
https://businessmirror.com.ph/2025/07/25/are-you-sleeping-well/
-
I find that as I’ve gotten older, sleep has become more elusive to me. I used to be able to sleep as long as 12 hours with minimal interruption.... In fact, until I was about in my 40s, “breakfast” was not even in my vocabulary. #KnowMore #SomethingLikeLife #sleeping #sleepdisorders
https://businessmirror.com.ph/2025/07/25/are-you-sleeping-well/
-
It’s hard for anyone to sleep when it’s hot out. Even harder as climate change pushes temperatures up around the globe. @npr has more on the increase in sleep apnea coinciding with hotter days and nights.
-
It’s hard for anyone to sleep when it’s hot out. Even harder as climate change pushes temperatures up around the globe. @npr has more on the increase in sleep apnea coinciding with hotter days and nights.
-
Our #SleeplessInHollywood panel on #SleepDisorders with our partners at #ProjectSleep is happening soon! Be sure to follow our panel via our social media channels on #Bluesky and #Instagram
-
Unraveling Insomnia: Your Guide to Restful Nights
#Insomnia #SleepHealth #SleepHygiene #SleepDisorders #RestfulNights #SleepScience #Polysomnography #SleepEfficiency #SleepBetter #MentalHealth #WellnessJourney #SleepTips #SweetDreams #TossingAndTurning #SleepPatterns #NighttimeRoutine
-
Updated website for Sighted Non-24. #CircadianRhythm #SleepDisorders #Non24 #DSPD www.sightednon-24.org
-
Updated website for Sighted Non-24. #CircadianRhythm #SleepDisorders #Non24 #DSPD www.sightednon-24.org
-
Sleep problems surprisingly common in adults with ADHD, study finds https://www.psypost.org/sleep-problems-surprisingly-common-in-adults-with-adhd-study-reveals/?utm_source=dlvr.it&utm_medium=mastodon #ADHD #SleepDisorders #MentalHealth #SleepHealth #PsychiatricComorbidities
-
Another example:
Sleep apnea causes hypersomnia SYMPTOM. When properly treated with the specific apnea appointed treatments done right, like CPAP, sometimes surgeries, lifestyle changes etc. the symptom improves as the primary issue improves.
Most people with apnea do improve when they find the right way to treat the issue.
If the hypersomnia persists when apnea improves - THEN there is no known explanation, and IH can be diagnosed.
-
Another example:
Sleep apnea causes hypersomnia SYMPTOM. When properly treated with the specific apnea appointed treatments done right, like CPAP, sometimes surgeries, lifestyle changes etc. the symptom improves as the primary issue improves.
Most people with apnea do improve when they find the right way to treat the issue.
If the hypersomnia persists when apnea improves - THEN there is no known explanation, and IH can be diagnosed.
-
The amount of people who mix hypersomnia THE SYMPTOM to Idiopathic Hypersomnia THE RARE NEUROLOGICAL SLEEP DISORDER WITHOUT KNOWN CAUSE is staggering.
If you know the root cause - sleepiness is a symptom that can be treated by dealing with the illness/sickness/issue that is causing it. It can even be eliminated if the illness is curable or properly treatable. That is a symptom, not a disorder.
Not. The. Same. Thing.
#sleep #disability #symptoms #idiopathichypersomnia #sleepdisorders
-
The amount of people who mix hypersomnia THE SYMPTOM to Idiopathic Hypersomnia THE RARE NEUROLOGICAL SLEEP DISORDER WITHOUT KNOWN CAUSE is staggering.
If you know the root cause - sleepiness is a symptom that can be treated by dealing with the illness/sickness/issue that is causing it. It can even be eliminated if the illness is curable or properly treatable. That is a symptom, not a disorder.
Not. The. Same. Thing.
#sleep #disability #symptoms #idiopathichypersomnia #sleepdisorders
-
Would you like to know what IH is really like?
Here is a mini-movie about it by #HypersomniaFoundationPlease share to spread #IdiopathicHypersomnia awareness! <3
https://www.youtube.com/watch?v=92OWvttSPUg
#Sleepdisorder #sleep #Sleepdisorders #hypersomnia #hypersomnolence #dreaming #tiredness #life #disability #disabilityAwareness
-
Would you like to know what IH is really like?
Here is a mini-movie about it by #HypersomniaFoundationPlease share to spread #IdiopathicHypersomnia awareness! <3
https://www.youtube.com/watch?v=92OWvttSPUg
#Sleepdisorder #sleep #Sleepdisorders #hypersomnia #hypersomnolence #dreaming #tiredness #life #disability #disabilityAwareness
-
Struggling to #Sleep with #ADHD? Watch This!
https://www.youtube.com/watch?v=5BndOfZ_9xQ
"Having trouble #sleeping with ADHD? Same. In this video, I talk about why it can be so hard to get to sleep when you have ADHD—like executive function struggles and common #sleepdisorders like #insomnia and #restlesslegsyndrome. Sleep is super important for managing ADHD, but it’s not always easy to get. Let’s break down what’s really going on so we can learn strategies for our sleep difficulties."