#sleepdisorders — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #sleepdisorders, aggregated by home.social.
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Please, 🥺 I need some advice.
Lately, I have been experiencing what I think is sleep paralysis. While I'm asleep, I become aware but can't move, speak, or even shake myself.
Sometimes it feels like something is holding me down, and it's hard to breathe.
Can sleep paralysis kill someone?Why does it happen, and why would it suddenly start now? Does it mean that I'm going to die🥺, Has anyone else experienced this?
#mentalhealthmatters #HealthyAdvice #sleepparalysis #sleepdisorders
-
Sleep deprivation linked to weight gain and larger waistline, study finds
Sleep expert dissects social media sleep trends During ‘Fox & Friends’ Wellness Week, sleep expert Dr. Rebecca Robbins…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health ##WomensHealth #sleepdisorders #weightloss #wellness
https://www.newsbeep.com/us/786222/ -
Sleep deprivation linked to weight gain and larger waistline, study finds
Sleep expert dissects social media sleep trends During ‘Fox & Friends’ Wellness Week, sleep expert Dr. Rebecca Robbins…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health ##WomensHealth #sleepdisorders #weightloss #wellness
https://www.newsbeep.com/us/786222/ -
Morning light exposure linked to deeper sleep and earlier wake time: study
‘Gutfeld!’: Make Daylight saving time permanent Sean Davis, CEO and co-founder of The Federalist, alongside comedian Joe Machi,…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Science #Health #HealthyLiving #Lifestyle #sleepdisorders #wellness
https://www.newsbeep.com/us/773634/ -
Morning light exposure linked to deeper sleep and earlier wake time: study
‘Gutfeld!’: Make Daylight saving time permanent Sean Davis, CEO and co-founder of The Federalist, alongside comedian Joe Machi,…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Science #Health #HealthyLiving #Lifestyle #sleepdisorders #wellness
https://www.newsbeep.com/us/773634/ -
Hidden Costs of Sleep Loss: Transform Your Health
Introduction
Discover the hidden costs of sleep loss and learn how poor sleep affects your health, mood, and daily performance. If you want to improve sleep quality, reduce muscle cramps, enhance recovery, and manage stress more effectively, this guide reveals actionable sleep tips and healthy sleep habits that help you reclaim restorative sleep and boost overall wellness.
The Wake-Up Call You Didn’t Know You Needed
Last Tuesday, I watched my friend Mark fumble through his morning presentation. He’d been up until 2 AM scrolling through his phone. By noon, he couldn’t remember his own talking points. His hands shook. His eyes looked hollow. He told me later, “I felt like a ghost haunting my own body.”
Sound familiar?
If you want to improve overall health and wellness, enhance sleep quality, reduce muscle cramps, enhance recovery, manage stress and anxiety more effectively, and maintain a balanced and healthy lifestyle—this post is for you.
Here’s the shocker: The Centers for Disease Control and Prevention (CDC) reports that 1 in 3 adults in the United States don’t get enough sleep on a regular basis. That’s over 100 million people walking around like zombies, paying a price they don’t even see coming.
In this post, you’ll discover how sleep loss quietly drains your health, your mind, and your happiness. You’ll learn science-backed sleep tips to improve sleep naturally. You’ll find out how better sleep transforms everything from your immune health to your heart health. And you’ll walk away with a clear plan to build healthy sleep habits starting tonight.
Ready to wake up to the truth? Let’s read on.
Why Your Body Is Screaming for Better Sleep
Story 1: Sarah’s Shocking Discovery
Sarah, a 34-year-old marketing manager from Austin, thought she was “fine” on five hours of sleep. She drank three coffees before lunch. She snapped at her kids. She gained 15 pounds in six months without changing her diet.
Then her doctor ran bloodwork. Her cortisol levels were through the roof. Her blood sugar hovered near pre-diabetic. Her doctor said one thing: “Your lack of sleep is destroying you from the inside out.”
Sarah broke down in the parking lot. She told me, “I thought I was being productive. I was actually breaking myself.”
Have you ever brushed off exhaustion as “just part of life”? What would your body tell you if it could speak up?
Story 2: James, the Weekend Warrior
James, a 42-year-old construction supervisor, laughed off his insomnia for years. “I’ll sleep when I’m dead,” he’d joke. Then his blood pressure spiked. His doctor found early signs of heart disease. At 42.
Research from the European Heart Journal (2019, led by Dr. Nicholas Bakalar) found that people with sleep disorders face a 20% higher risk of heart attack compared to those with healthy sleep patterns. James wasn’t laughing anymore.
When did you last check in with your heart health? Could your sleep habits be putting you at risk?
Story 3: The Night Nurse’s Nightmare
Maria, a night-shift nurse in Chicago, struggled with her circadian rhythm for a decade. She developed chronic muscle cramps. Her recovery after workouts slowed to a crawl. She felt anxious constantly.
After shifting to a consistent bedtime routine and using natural sleep remedies, Maria noticed changes within weeks. “My cramps disappeared. My anxiety dropped by half. I finally feel like myself again,” she shared.
Do you work odd hours? How has that affected your sleep quality and muscle recovery?
Story 4: The College Student’s Crash
Tyler, a 21-year-old engineering student, pulled all-nighters regularly. His grades tanked. His memory failed him during exams. He developed severe anxiety.
A 2021 study published in Nature and Science of Sleep (researchers from the University of Michigan) found that sleep deprivation reduces cognitive performance by up to 40%. Tyler’s brain wasn’t broken. It was exhausted.
Did you know that staying up to study can actually make you perform worse? What’s your experience with late-night cramming?
Story 5: The New Mom’s Transformation
Priya, a 38-year-old new mother, hadn’t slept more than four hours straight in months. She felt disconnected from her baby. She cried daily. Her immune health crumbled—she caught every cold that circulated.
After implementing sleep hygiene strategies and accepting help from her partner, Priya’s world shifted. “I finally have the energy to be the mom I want to be. My immune system bounced back. I feel human again.”
New parents: How are you prioritizing your own sleep while caring for little ones?
Story 6: The Executive’s Epiphany
Robert, a 55-year-old CEO, wore his four-hour sleep schedule like a badge of honor. Then he fell asleep at the wheel. Luckily, he only hit a curb. His doctor found his testosterone levels had crashed. His mental health suffered.
A 2020 study in the Journal of the American Medical Association (JAMA) led by Dr. Rachel Leproult found that just one week of restricted sleep reduces testosterone by 10-15% in young, healthy men. Robert wasn’t “tough.” He was self-sabotaging.
Have you ever worn exhaustion like a badge of honor? What would it take to change that mindset?
What Sleep Loss Really Does to Your Body
Sleep Deprivation Isn’t Just Feeling Tired
Most people think sleep loss means yawning. They couldn’t be more wrong.
Sleep deprivation triggers a cascade of damage across every system in your body. Here’s what the science says:
- Your brain shrinks. A 2017 study from the University of California, Los Angeles (UCLA), led by Dr. Itzhak Fried, found that sleep deprivation disrupts brain cell communication, leading to temporary mental lapses. Your brain literally can’t process information correctly.
- Your immune system weakens. Research from the University of California, San Francisco (2015, Dr. Aric Prather) showed that people who sleep less than six hours per night are four times more likely to catch a cold than those who sleep seven hours or more.
- Your heart suffers. The American Heart Association warns that chronic sleep loss increases the risk of high blood pressure, heart disease, and stroke.
- Your metabolism crashes. A study in the Annals of Internal Medicine (2012, researchers from the University of Chicago) found that insufficient sleep reduces fat loss by 55% even when calories stay the same.
- Your mental health deteriorates. The National Institute of Mental Health links chronic insomnia to a tenfold increase in depression risk.
Which of these effects surprises you most? Drop a comment and let me know.
How Sleep Loss Shows Up in Your Daily Life
You Feel It Everywhere
Sleep loss doesn’t hide. It announces itself loudly:
- Morning fog. You can’t think clearly before noon.
- Afternoon crashes. You need caffeine to function.
- Irritability. Small things set you off.
- Sugar cravings. Your body begs for quick energy.
- Muscle cramps. Your recovery stalls. Your muscles seize up.
- Anxiety spikes. Everything feels overwhelming.
- Memory gaps. You forget names, appointments, conversations.
- Weight gain. Your hormones work against you.
- Weakened immunity. You catch every bug.
- Low libido. Your hormones flatline.
Dr. Matthew Walker, neuroscientist and author of Why We Sleep, puts it bluntly: “The shorter your sleep, the shorter your life.”
How many of these pain points do you recognize in your own life? Be honest—how many showed up today?
Understanding Sleep Science and Why We Need Rest
What Happens When You Actually Sleep?
Sleep isn’t passive. It’s active restoration.
Your body cycles through stages:
- Light sleep. Your body transitions. Your heart rate drops.
- Deep sleep. Your body repairs tissue. Your immune system strengthens. Your muscles recover.
- REM sleep. Your brain processes emotions. Your memory consolidates. Your creativity sparks.
You need all three. Miss deep sleep, and your muscles ache. Miss REM, and your mental health crumbles.
The Circadian Rhythm: Your Internal Clock
Your circadian rhythm controls when you feel awake and when you feel sleepy. It responds to light. It craves consistency.
When you ignore it—staying up late, sleeping in on weekends, staring at screens—you throw off your entire system. Your body doesn’t know when to rest. Your hormones go haywire.
A 2018 study from Northwestern University (Dr. Phyllis Zee) found that irregular sleep patterns increase the risk of cardiovascular disease by 11% compared to consistent sleepers.
The Role of Sleep Hygiene
Sleep hygiene isn’t about cleanliness. It’s about habits. Good sleep hygiene means:
- Going to bed at the same time every night
- Keeping your bedroom cool, dark, and quiet
- Avoiding screens for at least an hour before bed
- Limiting caffeine after 2 PM
- Creating a relaxing bedtime routine
Small changes here create massive results.
What’s your current bedtime routine? Does it support your circadian rhythm or fight it?
Real Solutions to Improve Sleep Naturally
Build Your Sleep Toolkit
Here’s where transformation happens. These sleep tips work. I’ve seen them change lives.
#1- Fix Your Sleep Environment
- Keep your bedroom between 60-67°F
- Use blackout curtains or an eye mask
- Try white noise or earplugs
- Remove all screens from your bedroom
- Invest in a quality mattress and pillow
#2- Master Your Bedtime Routine
- Start winding down 60 minutes before bed
- Take a warm bath or shower
- Read a physical book (not on a tablet)
- Try gentle stretching or meditation
- Write down worries in a journal to clear your mind
#3- Support Your Circadian Rhythm
- Wake up at the same time every day—even weekends
- Get morning sunlight within 30 minutes of waking
- Avoid blue light after sunset
- Limit naps to 20-30 minutes
- Avoid heavy meals within three hours of bedtime
#4- Use Natural Sleep Remedies Wisely
- Magnesium glycinate supports muscle relaxation and reduces cramps
- L-theanine promotes calm without drowsiness
- Valerian root has mild sedative effects
- Chamomile tea soothes the nervous system
- Melatonin works best for jet lag, not nightly use
Always consult your doctor before starting supplements.
#5- Manage Stress for Better Sleep
- Practice deep breathing before bed
- Try progressive muscle relaxation
- Use guided sleep meditations
- Keep work stress out of the bedroom
- Exercise regularly—but not right before bed
#6- Eat for Sleep
- Limit caffeine after 2 PM
- Avoid alcohol close to bedtime (it fragments sleep)
- Eat magnesium-rich foods: spinach, almonds, avocado
- Include tryptophan sources: turkey, eggs, nuts
- Skip spicy or heavy late-night meals
The Recovery Connection
Better sleep directly enhances recovery. During deep sleep, your body releases growth hormone. This hormone repairs muscle tissue, reduces inflammation, and restores energy stores.
Athletes who prioritize sleep see:
- Faster reaction times
- Reduced injury rates
- Better endurance
- Improved focus
A 2011 study from Stanford University (led by Dr. Cheri Mah) found that basketball players who extended sleep to 10 hours per night improved sprint times by 4.5% and free-throw accuracy by 9%.
Which of these strategies will you try first? Pick one and commit to it for the next seven days.
Conclusion: Your Path to Restorative Sleep Starts Now
The Hidden Costs Add Up—But So Do the Benefits
Sleep loss steals more than energy. It chips away at your heart health, your brain health, your immune health, and your mental health. It fuels stress and anxiety. It slows recovery. It triggers muscle cramps. It dims your productivity and joy.
But here’s the beautiful truth: every night offers a fresh start.
When you prioritize sleep quality, everything shifts:
- Your mind sharpens.
- Your mood stabilizes.
- Your body recovers.
- Your energy soars.
- Your relationships deepen.
- Your life expands.
You don’t need perfection. You need progress. One better night leads to another. One healthy sleep habit builds momentum.
Key Takeaways
- Sleep loss affects every system in your body—not just your energy levels
- Consistency matters more than perfection for your circadian rhythm
- Your sleep environment directly impacts sleep quality
- Natural sleep remedies and good sleep hygiene work together
- Better sleep enhances recovery, reduces cramps, and supports mental health
- Small changes tonight create big results tomorrow
Call to Action: Take the First Step Tonight
I want to hear from you.
What’s your biggest sleep struggle right now? Drop it in the comments below. Let’s figure it out together.
Which sleep tip from this post will you try first? Share your commitment. I’ll check back.
Know someone running on empty? Share this post with them. Tag a friend who needs to read this. Post it to your social media. Let’s spread the message that sleep matters.
Tonight, pick one strategy from this guide. Just one. Set your alarm for the same time tomorrow. Dim the lights. Put the phone down. Your body will thank you.
Sweet dreams start with a single decision. Make yours now.
Watch this video: Discover the Hidden Costs of Sleep Loss: The Silent Health Risk You Can’t Ignore
Real Stories: How Better Sleep Changed Lives
From Exhausted to Energized: 8 Powerful Transformations
#1- Linda, 45, Teacher from Denver
Linda suffered from chronic insomnia for eight years. She tried everything—pills, teas, apps. Nothing stuck. Then she committed to a strict bedtime routine: lights out at 10 PM, no screens after 9 PM, magnesium before bed.
Within three months, her anxiety dropped dramatically. Her students noticed she smiled more. “I finally feel like the teacher I always wanted to be,” she says.
#2- Marcus, 29, Software Developer from Seattle
Marcus worked remote and blurred all boundaries. He coded until 2 AM, slept until 10 AM, and felt like garbage. After learning about circadian rhythm science, he started waking at 7 AM daily, getting morning sunlight, and shutting down work by 8 PM.
His productivity actually increased. “I get more done in six focused hours than I used to in twelve foggy ones,” he reports.
#3- Elena, 52, Yoga Instructor from Miami
Elena dealt with nightly muscle cramps that woke her screaming. She increased her magnesium intake, adjusted her sleep position, and prioritized deep sleep by keeping her room cooler.
“The cramps stopped within two weeks. My recovery after teaching improved. I feel twenty years younger,” she shares.
#4- David, 37, Firefighter from Boston
David’s shift work destroyed his sleep schedule. He developed high blood pressure at 35. Working with a sleep specialist, he created a blackout environment for daytime sleep, used melatonin strategically, and protected his sleep window fiercely.
His blood pressure normalized. “I literally saved my own life by taking sleep seriously,” he says.
#5- Aisha, 31, Entrepreneur from Atlanta
Aisha ran her business on four hours of sleep and endless energy drinks. She crashed—hard. A doctor found her cortisol levels resembled someone in chronic danger. She rebuilt her sleep hygiene from scratch.
“Within a month, my decision-making improved. My creativity returned. My business grew 30% in the next quarter because I could actually think clearly,” she explains.
#6- Tom, 60, Retired Police Officer from Phoenix
Tom retired but couldn’t sleep. Years of night shifts had broken his circadian rhythm. He started a consistent wake time, light therapy in the morning, and a relaxing bedtime routine. He also began walking after dinner.
“For the first time in thirty years, I sleep through the night. My memory improved. My wife says I’m present again,” Tom shares.
#7- Rachel, 26, Graduate Student from New York
Rachel’s anxiety kept her awake, which made her more anxious—a vicious cycle. She started journaling before bed, practicing box breathing, and using a weighted blanket.
“I went from three hours of broken sleep to seven hours of solid rest. My grades improved. My panic attacks stopped. Sleep changed my life,” she says.
#8- The Chen Family from San Francisco
The entire Chen family—parents Mike and Jennifer, plus kids aged 8 and 12—struggled with screen time before bed. They implemented a family “digital sunset” at 8 PM. They read together. They talked.
“Not only do the kids sleep better, but our family connection deepened. We actually know what’s happening in each other’s lives now,” Jennifer says.
Which story resonates with you most? Share your own sleep journey in the comments.
Frequently Asked Questions About Sleep Loss and Sleep Health
#1- How much sleep do adults actually need?
Most adults need 7 to 9 hours of quality sleep per night. Some people function well on slightly less, but fewer than 6 hours consistently leads to measurable health decline. Listen to your body—if you need an alarm to wake up, you probably need more sleep.
#2- Can you “catch up” on sleep during weekends?
Research says no. A 2019 study from the University of Colorado Boulder (led by Dr. Kenneth Wright) found that weekend recovery sleep doesn’t reverse the metabolic damage caused by weekday sleep loss. Consistency wins over catch-up sleep every time.
#3- What’s the best natural sleep remedy for muscle cramps?
Magnesium glycinate tops the list. It supports muscle relaxation, reduces cramping, and promotes calm. Many people are magnesium-deficient without knowing it. Food sources include leafy greens, nuts, seeds, and dark chocolate.
#4- How does sleep loss affect mental health specifically?
Sleep deprivation increases activity in the amygdala—your brain’s fear center—while reducing communication with the prefrontal cortex, which regulates emotions. This creates a perfect storm for anxiety, irritability, and depression. Dr. Matthew Walker’s research shows that sleep disruption precedes most mental health disorders.
#5- Is it okay to use melatonin every night?
Melatonin works best for short-term issues like jet lag or shift work adjustment. For chronic insomnia, it offers limited benefit. Long-term nightly use may disrupt your body’s natural production. Talk to your doctor about underlying causes instead of masking symptoms.
#6- What’s the single most important sleep hygiene habit?
Consistency. Going to bed and waking up at the same time every day—even weekends—anchors your circadian rhythm more powerfully than any other habit. Your body craves predictability.
#7- How quickly can I see results from improving my sleep habits?
Most people notice improved energy and mood within 3 to 7 days. Physical benefits like reduced inflammation, better recovery, and weight regulation typically show within 2 to 4 weeks. Brain health improvements—memory, focus, creativity—often become noticeable around the 4 to 6 weeks mark.
#8- Can poor sleep really cause weight gain?
Yes. Sleep loss disrupts two key hormones: ghrelin (hunger hormone) increases, and leptin (satiety hormone) decreases. This makes you hungrier while feeling less full. Additionally, sleep deprivation increases cravings for high-calorie, sugary foods. A 2013 study from the University of Colorado found that just five nights of restricted sleep led to an average weight gain of two pounds.
Have a question I didn’t answer? Drop it in the comments. I read every single one.
References and Further Reading
- Centers for Disease Control and Prevention (CDC). “1 in 3 adults don’t get enough sleep.” https://www.cdc.gov/sleep/data_statistics.html
- Bakalar, N. et al. “Sleep disorders and cardiovascular risk.” European Heart Journal, 2019. https://www.heart.org/en/health-topics/sleep-disorders/sleep-and-heart-health
- University of Michigan. “Sleep deprivation and cognitive performance.” Nature and Science of Sleep, 2021. https://www.sciencedirect.com/science/article/pii/S2667242126000102
- Leproult, R. et al. “Impact of sleep restriction on testosterone.” Journal of the American Medical Association (JAMA), 2020. https://www.sleepfoundation.org/physical-health/sleep-and-testosterone
- Fried, I. et al. “Sleep deprivation and neuronal lapses.” Nature Medicine, 2017.
https://www.nature.com/articles/s41593-025-02098-8
- Prather, A. et al. “Sleep and susceptibility to the common cold.” Sleep, 2015. https://link.springer.com/article/10.1007/s42399-020-00265-5
- University of Chicago. “Sleep restriction and fat loss.” Annals of Internal Medicine, 2012. https://scienceinsights.org/how-does-sleep-affect-weight-loss-and-fat-storage/
- Zee, P. et al. “Irregular sleep patterns and cardiovascular disease.” Scientific Reports, 2018. https://link.springer.com/article/10.1186/s12872-026-05762-4
- Mah, C. et al. “The effects of sleep extension on athletic performance.” Sleep, 2011. https://research.poin-t-go.com/en/research/sleep-extension-athlete-performance
- Wright, K. et al. “Weekend recovery sleep and metabolic health.” Current Biology, 2019. https://medicine.nus.edu.sg/wp-content/uploads/2025/12/Press-Release-Short-and-irregular-weekday-sleep-disrupts-glucose-regulation-even-after-weekend-sleep-recovery-NUS-Medicine-study-reveals_media-use.pdf
- Walker, M. Why We Sleep: Unlocking the Power of Sleep and Dreams. Scribner, 2017.
Now it’s your turn. What’s one thing you’ll change about your sleep tonight? Share below. And if this post opened your eyes, share it with someone who needs to wake up to the hidden costs of sleep loss. 💤
For more reading on sleep matters:
- Transform Your Sleep: The Power of a Magnesium Night Routine
- How Magnesium Enhances Muscle Recovery and Sleep Quality
- Harness Magnesium for Stress Relief and Better Sleep
- Transform Your Life with Magnesium: Stress Relief and Better Sleep
- Magnesium: The Key to Stress Relief and Better Sleep
- The Magnesium Miracle: Transform Your Stress and Sleep
- Best Sleeping Positions to Alleviate Joint Pain
- Stress and Sleep: Unlock Deeper Rest with These Techniques
- Unlock Peaceful Sleep with Ancient Breathing Techniques
- Why Your Sleep Routine Isn’t Working for Fatigue
- Natural Sleep Remedies: Unlock the Secrets of Thai Massage
- Magnesium Myths vs Facts: Transform Your Sleep and Stress
- 7-Day Sleep Transformation Plan for Health and Happiness
- 10 Sleep Hygiene Tips for Restful Nights
- Cherries: Your Secret to Better Sleep and Recovery
-
Sleep Water Enhancers Market Report Just Released, Profiles Unilever, PepsiCo, Suntory, and 17 Other Players
In a strategic move to broaden its wellness portfolio, Foria, a producer of plant-based wellness products, acquired Ned…
#EuropeSays #Britain #Europe #EU #Unilever #DistributionChannels #marketsize #Sleep #sleepdisorders #SleepWater #sleepwaterenhancers #WaterEnhancers
https://www.europesays.com/britain/82751/ -
https://www.europesays.com/britain/82751/ Sleep Water Enhancers Market Report Just Released, Profiles Unilever, PepsiCo, Suntory, and 17 Other Players #DistributionChannels #MarketSize #Sleep #SleepDisorders #SleepWater #SleepWaterEnhancers #Unilever #WaterEnhancers
-
Sleep Water Enhancers Market Report Just Released, Profiles Unilever, PepsiCo, Suntory, and 17 Other Players
In a strategic move to broaden its wellness portfolio, Foria, a producer of plant-based wellness products, acquired Ned…
#EuropeSays #Britain #Europe #EU #Unilever #DistributionChannels #marketsize #Sleep #sleepdisorders #SleepWater #sleepwaterenhancers #WaterEnhancers
https://www.europesays.com/britain/82054/ -
https://www.europesays.com/britain/82054/ Sleep Water Enhancers Market Report Just Released, Profiles Unilever, PepsiCo, Suntory, and 17 Other Players #DistributionChannels #MarketSize #Sleep #SleepDisorders #SleepWater #SleepWaterEnhancers #Unilever #WaterEnhancers
-
DATE: July 6, 2026 at 08:00AM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: People with migraines experience restless legs syndrome at twice the normal rate
About one in five people who suffer from migraines also experience restless legs syndrome, roughly double the prevalence observed in the general public. This elevated frequency is highly pronounced among patients who endure chronic head pain or migraines accompanied by visual auras. The meta-analysis detailing these patterns was published in the Journal of Sleep Research.
Migraine is a neurological disorder characterized by recurrent attacks of throbbing head pain, often alongside nausea and extreme sensitivity to light or sound. Restless legs syndrome is a sensorimotor condition defined by an overwhelming urge to move the lower limbs. Patients typically experience uncomfortable crawling or aching sensations that worsen during periods of rest, particularly at night, and find temporary relief only through physical movement.
Medical professionals have noted that these two distinct conditions frequently appear in the same patients. To better understand this overlap, Simona Raimo, a researcher at the Magna Graecia University of Catanzaro in Italy, led a team to investigate the exact prevalence and clinical factors uniting the two disorders. The researchers aimed to aggregate existing data to offer distinct clinical guidance on how to manage patients facing both ailments simultaneously.
Single medical studies often involve a restricted number of participants, which can severely limit the statistical reliability of their conclusions. To overcome this hurdle, the researchers conducted a meta-analysis, a statistical technique that pools data from multiple independent studies to reveal broader patterns. Raimo and her team eventually isolated 30 high-quality studies published previously.
In total, the aggregated data encompassed 20,781 adult participants who had been diagnosed with migraines. Within this massive sample, 3,343 individuals also carried a full diagnosis of restless legs syndrome. By combining the available hospital data, the researchers calculated an overall pooled prevalence of 20 percent. For context, restless legs syndrome affects roughly 5 to 10 percent of the general population.
The researchers also looked at demographic traits to see if specific populations were at higher risk. Advancing age emerged as a consistent factor across the reviewed studies. Older adults naturally experience gradual changes in their dopamine production and iron metabolism, potentially explaining the higher rate of the sleep disorder in older age brackets. Although migraines are generally more common in women, sex did not produce statistically significant differences regarding the co-occurrence of the two conditions.
The specific type of migraine a patient experiences plays a major role in their overall risk profile. Migraine with aura involves sensory disturbances, such as seeing flashing lights or experiencing blind spots, that precede the onset of actual head pain. The researchers found an elevated association between restless legs syndrome and both chronic migraines and migraines with aura.
Conversely, no association was found for individuals who experience episodic migraines without an accompanying aura. The researchers suggest that as migraines become more frequent and progress into a chronic state, the physical signs of the sleep disorder become more apparent. The disease chronification process may amplify shared neurophysiological pathways in the human nervous system.
This progression aligns with a medical concept known as central sensitization. When the brain and spinal cord receive constant pain signals over many years, the nervous system can become hyper-reactive. Normal sensory inputs are suddenly processed as painful or intensely uncomfortable sensations. The researchers propose that chronic sensory input from frequent headaches, combined with the sensory dysregulation of restless legs, amplifies this heightened state of physiological alert.
Beyond clinical diagnoses, behavioral symptoms heavily influenced the co-occurrence of these conditions. Patients coping with both ailments were much more likely to report severe depressive symptoms, higher overall pain intensity, and poor sleep quality compared to those with migraines alone. Symptoms of anxiety did not reach a statistically significant association, suggesting the emotional burden leans more heavily toward depression than physical hyperarousal.
Sleep disturbances play a particularly destructive role in this dual cycle. Restless legs syndrome often involves involuntary muscle twitches that occur during actual sleep. These sudden movements produce tiny nervous system awakenings, known as micro-arousals, that prevent a person from reaching deep, restorative stages of rest. Severe sleep deprivation is a well-documented trigger for intense migraines, which creates a negative feedback loop where poor sleep generates physical pain, and physical pain disrupts rest.
The exact biological mechanisms linking migraines and restless legs syndrome remain an active area of widespread scientific investigation. One major leading theory involves the brain’s dopaminergic system. Dopamine is a chemical messenger that helps the nervous system regulate physical movement, human mood, and sensory processing.
In restless legs syndrome, abnormalities in specific dopamine pathways alter sensory processing in the spinal cord and cortex, resulting in nocturnal restlessness. In individuals with migraines, there is modern medical evidence that the brain becomes highly sensitive to dopamine. This heightened sensitivity can trigger physical symptoms like frequent yawning, intense nausea, and gastrointestinal issues just before a headache episode takes hold.
Iron regulation provides another potential biological overlap. Iron is a necessary molecular element for the human brain to synthesize dopamine properly. Patients with restless legs syndrome frequently exhibit iron deficiencies in the central nervous system, while individuals with frequent migraines often show abnormal iron accumulation in specific deep brain regions.
Recognizing this medical overlap has immediate implications for patient treatment, primarily because commonly prescribed medications can cause adverse physical interactions. Doctors frequently prescribe specific antidepressants or anti-nausea drugs to help patients manage migraine symptoms. Some of these pharmaceuticals can inadvertently trigger or exacerbate the uncomfortable physical sensations associated with restless legs syndrome.
The reverse medical reaction is also true in many hospital settings. Dopamine agonists are a specific class of drugs standardly used to calm limb movements in patients with movement disorders. If given to someone with a history of migraines, these same medications can provoke severe headache episodes. The researchers suggest that clinicians screen migraine patients for sleep disorders before finalizing a pharmaceutical protocol.
If a patient suffers from both conditions, doctors may need to pivot to alternative medications, such as specific anticonvulsant drugs, that can simultaneously soothe irritated nerves without aggravating either disorder. The study authors also advise non-pharmacological interventions, including strict sleep hygiene protocols, psychological therapies, and regular physical exercise. These lifestyle modifications can improve sleep efficiency and lift depressive symptoms without the risk of dangerous drug interactions.
The researchers outlined a few limitations in the available clinical data. The 30 studies utilized varying diagnostic questionnaires to identify sleep disorders, which introduced a high degree of statistical heterogeneity into the final results. Very few past studies have categorized patients using the most updated international criteria for headache disorders.
Future research should incorporate modern imaging techniques to observe the brains of patients experiencing both conditions simultaneously. Tracking iron levels, dopamine receptor activity, and the brain’s electrical excitability over a longer time horizon could isolate the precise biological origin point of this overlap. By tracking these variables over several years, scientists hope to develop targeted therapies that soothe the nervous system entirely.
The study, “Migraine and Restless Legs Syndrome: A Meta-Analysis,” was authored by Florindo d’Onofrio, Maria Cropano, Giada Panzino, Mariachiara Gaita, Giulio Cicarelli, Piero Barbanti, Gerardo Casucci, Simona Raimo, and Antonio Costanzo.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #MigraineAndRestlessLegs #MigrainesWithAura #RestlessLegsSyndrome #SleepDisorders #ChronicMigraine #DAdopamine #IronMetabolism #SleepHygiene #MentalHealthAwareness #NeuroScienceResearch
-
DATE: July 6, 2026 at 08:00AM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: People with migraines experience restless legs syndrome at twice the normal rate
About one in five people who suffer from migraines also experience restless legs syndrome, roughly double the prevalence observed in the general public. This elevated frequency is highly pronounced among patients who endure chronic head pain or migraines accompanied by visual auras. The meta-analysis detailing these patterns was published in the Journal of Sleep Research.
Migraine is a neurological disorder characterized by recurrent attacks of throbbing head pain, often alongside nausea and extreme sensitivity to light or sound. Restless legs syndrome is a sensorimotor condition defined by an overwhelming urge to move the lower limbs. Patients typically experience uncomfortable crawling or aching sensations that worsen during periods of rest, particularly at night, and find temporary relief only through physical movement.
Medical professionals have noted that these two distinct conditions frequently appear in the same patients. To better understand this overlap, Simona Raimo, a researcher at the Magna Graecia University of Catanzaro in Italy, led a team to investigate the exact prevalence and clinical factors uniting the two disorders. The researchers aimed to aggregate existing data to offer distinct clinical guidance on how to manage patients facing both ailments simultaneously.
Single medical studies often involve a restricted number of participants, which can severely limit the statistical reliability of their conclusions. To overcome this hurdle, the researchers conducted a meta-analysis, a statistical technique that pools data from multiple independent studies to reveal broader patterns. Raimo and her team eventually isolated 30 high-quality studies published previously.
In total, the aggregated data encompassed 20,781 adult participants who had been diagnosed with migraines. Within this massive sample, 3,343 individuals also carried a full diagnosis of restless legs syndrome. By combining the available hospital data, the researchers calculated an overall pooled prevalence of 20 percent. For context, restless legs syndrome affects roughly 5 to 10 percent of the general population.
The researchers also looked at demographic traits to see if specific populations were at higher risk. Advancing age emerged as a consistent factor across the reviewed studies. Older adults naturally experience gradual changes in their dopamine production and iron metabolism, potentially explaining the higher rate of the sleep disorder in older age brackets. Although migraines are generally more common in women, sex did not produce statistically significant differences regarding the co-occurrence of the two conditions.
The specific type of migraine a patient experiences plays a major role in their overall risk profile. Migraine with aura involves sensory disturbances, such as seeing flashing lights or experiencing blind spots, that precede the onset of actual head pain. The researchers found an elevated association between restless legs syndrome and both chronic migraines and migraines with aura.
Conversely, no association was found for individuals who experience episodic migraines without an accompanying aura. The researchers suggest that as migraines become more frequent and progress into a chronic state, the physical signs of the sleep disorder become more apparent. The disease chronification process may amplify shared neurophysiological pathways in the human nervous system.
This progression aligns with a medical concept known as central sensitization. When the brain and spinal cord receive constant pain signals over many years, the nervous system can become hyper-reactive. Normal sensory inputs are suddenly processed as painful or intensely uncomfortable sensations. The researchers propose that chronic sensory input from frequent headaches, combined with the sensory dysregulation of restless legs, amplifies this heightened state of physiological alert.
Beyond clinical diagnoses, behavioral symptoms heavily influenced the co-occurrence of these conditions. Patients coping with both ailments were much more likely to report severe depressive symptoms, higher overall pain intensity, and poor sleep quality compared to those with migraines alone. Symptoms of anxiety did not reach a statistically significant association, suggesting the emotional burden leans more heavily toward depression than physical hyperarousal.
Sleep disturbances play a particularly destructive role in this dual cycle. Restless legs syndrome often involves involuntary muscle twitches that occur during actual sleep. These sudden movements produce tiny nervous system awakenings, known as micro-arousals, that prevent a person from reaching deep, restorative stages of rest. Severe sleep deprivation is a well-documented trigger for intense migraines, which creates a negative feedback loop where poor sleep generates physical pain, and physical pain disrupts rest.
The exact biological mechanisms linking migraines and restless legs syndrome remain an active area of widespread scientific investigation. One major leading theory involves the brain’s dopaminergic system. Dopamine is a chemical messenger that helps the nervous system regulate physical movement, human mood, and sensory processing.
In restless legs syndrome, abnormalities in specific dopamine pathways alter sensory processing in the spinal cord and cortex, resulting in nocturnal restlessness. In individuals with migraines, there is modern medical evidence that the brain becomes highly sensitive to dopamine. This heightened sensitivity can trigger physical symptoms like frequent yawning, intense nausea, and gastrointestinal issues just before a headache episode takes hold.
Iron regulation provides another potential biological overlap. Iron is a necessary molecular element for the human brain to synthesize dopamine properly. Patients with restless legs syndrome frequently exhibit iron deficiencies in the central nervous system, while individuals with frequent migraines often show abnormal iron accumulation in specific deep brain regions.
Recognizing this medical overlap has immediate implications for patient treatment, primarily because commonly prescribed medications can cause adverse physical interactions. Doctors frequently prescribe specific antidepressants or anti-nausea drugs to help patients manage migraine symptoms. Some of these pharmaceuticals can inadvertently trigger or exacerbate the uncomfortable physical sensations associated with restless legs syndrome.
The reverse medical reaction is also true in many hospital settings. Dopamine agonists are a specific class of drugs standardly used to calm limb movements in patients with movement disorders. If given to someone with a history of migraines, these same medications can provoke severe headache episodes. The researchers suggest that clinicians screen migraine patients for sleep disorders before finalizing a pharmaceutical protocol.
If a patient suffers from both conditions, doctors may need to pivot to alternative medications, such as specific anticonvulsant drugs, that can simultaneously soothe irritated nerves without aggravating either disorder. The study authors also advise non-pharmacological interventions, including strict sleep hygiene protocols, psychological therapies, and regular physical exercise. These lifestyle modifications can improve sleep efficiency and lift depressive symptoms without the risk of dangerous drug interactions.
The researchers outlined a few limitations in the available clinical data. The 30 studies utilized varying diagnostic questionnaires to identify sleep disorders, which introduced a high degree of statistical heterogeneity into the final results. Very few past studies have categorized patients using the most updated international criteria for headache disorders.
Future research should incorporate modern imaging techniques to observe the brains of patients experiencing both conditions simultaneously. Tracking iron levels, dopamine receptor activity, and the brain’s electrical excitability over a longer time horizon could isolate the precise biological origin point of this overlap. By tracking these variables over several years, scientists hope to develop targeted therapies that soothe the nervous system entirely.
The study, “Migraine and Restless Legs Syndrome: A Meta-Analysis,” was authored by Florindo d’Onofrio, Maria Cropano, Giada Panzino, Mariachiara Gaita, Giulio Cicarelli, Piero Barbanti, Gerardo Casucci, Simona Raimo, and Antonio Costanzo.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #MigraineAndRestlessLegs #MigrainesWithAura #RestlessLegsSyndrome #SleepDisorders #ChronicMigraine #DAdopamine #IronMetabolism #SleepHygiene #MentalHealthAwareness #NeuroScienceResearch
-
DATE: July 6, 2026 at 08:00AM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: People with migraines experience restless legs syndrome at twice the normal rate
About one in five people who suffer from migraines also experience restless legs syndrome, roughly double the prevalence observed in the general public. This elevated frequency is highly pronounced among patients who endure chronic head pain or migraines accompanied by visual auras. The meta-analysis detailing these patterns was published in the Journal of Sleep Research.
Migraine is a neurological disorder characterized by recurrent attacks of throbbing head pain, often alongside nausea and extreme sensitivity to light or sound. Restless legs syndrome is a sensorimotor condition defined by an overwhelming urge to move the lower limbs. Patients typically experience uncomfortable crawling or aching sensations that worsen during periods of rest, particularly at night, and find temporary relief only through physical movement.
Medical professionals have noted that these two distinct conditions frequently appear in the same patients. To better understand this overlap, Simona Raimo, a researcher at the Magna Graecia University of Catanzaro in Italy, led a team to investigate the exact prevalence and clinical factors uniting the two disorders. The researchers aimed to aggregate existing data to offer distinct clinical guidance on how to manage patients facing both ailments simultaneously.
Single medical studies often involve a restricted number of participants, which can severely limit the statistical reliability of their conclusions. To overcome this hurdle, the researchers conducted a meta-analysis, a statistical technique that pools data from multiple independent studies to reveal broader patterns. Raimo and her team eventually isolated 30 high-quality studies published previously.
In total, the aggregated data encompassed 20,781 adult participants who had been diagnosed with migraines. Within this massive sample, 3,343 individuals also carried a full diagnosis of restless legs syndrome. By combining the available hospital data, the researchers calculated an overall pooled prevalence of 20 percent. For context, restless legs syndrome affects roughly 5 to 10 percent of the general population.
The researchers also looked at demographic traits to see if specific populations were at higher risk. Advancing age emerged as a consistent factor across the reviewed studies. Older adults naturally experience gradual changes in their dopamine production and iron metabolism, potentially explaining the higher rate of the sleep disorder in older age brackets. Although migraines are generally more common in women, sex did not produce statistically significant differences regarding the co-occurrence of the two conditions.
The specific type of migraine a patient experiences plays a major role in their overall risk profile. Migraine with aura involves sensory disturbances, such as seeing flashing lights or experiencing blind spots, that precede the onset of actual head pain. The researchers found an elevated association between restless legs syndrome and both chronic migraines and migraines with aura.
Conversely, no association was found for individuals who experience episodic migraines without an accompanying aura. The researchers suggest that as migraines become more frequent and progress into a chronic state, the physical signs of the sleep disorder become more apparent. The disease chronification process may amplify shared neurophysiological pathways in the human nervous system.
This progression aligns with a medical concept known as central sensitization. When the brain and spinal cord receive constant pain signals over many years, the nervous system can become hyper-reactive. Normal sensory inputs are suddenly processed as painful or intensely uncomfortable sensations. The researchers propose that chronic sensory input from frequent headaches, combined with the sensory dysregulation of restless legs, amplifies this heightened state of physiological alert.
Beyond clinical diagnoses, behavioral symptoms heavily influenced the co-occurrence of these conditions. Patients coping with both ailments were much more likely to report severe depressive symptoms, higher overall pain intensity, and poor sleep quality compared to those with migraines alone. Symptoms of anxiety did not reach a statistically significant association, suggesting the emotional burden leans more heavily toward depression than physical hyperarousal.
Sleep disturbances play a particularly destructive role in this dual cycle. Restless legs syndrome often involves involuntary muscle twitches that occur during actual sleep. These sudden movements produce tiny nervous system awakenings, known as micro-arousals, that prevent a person from reaching deep, restorative stages of rest. Severe sleep deprivation is a well-documented trigger for intense migraines, which creates a negative feedback loop where poor sleep generates physical pain, and physical pain disrupts rest.
The exact biological mechanisms linking migraines and restless legs syndrome remain an active area of widespread scientific investigation. One major leading theory involves the brain’s dopaminergic system. Dopamine is a chemical messenger that helps the nervous system regulate physical movement, human mood, and sensory processing.
In restless legs syndrome, abnormalities in specific dopamine pathways alter sensory processing in the spinal cord and cortex, resulting in nocturnal restlessness. In individuals with migraines, there is modern medical evidence that the brain becomes highly sensitive to dopamine. This heightened sensitivity can trigger physical symptoms like frequent yawning, intense nausea, and gastrointestinal issues just before a headache episode takes hold.
Iron regulation provides another potential biological overlap. Iron is a necessary molecular element for the human brain to synthesize dopamine properly. Patients with restless legs syndrome frequently exhibit iron deficiencies in the central nervous system, while individuals with frequent migraines often show abnormal iron accumulation in specific deep brain regions.
Recognizing this medical overlap has immediate implications for patient treatment, primarily because commonly prescribed medications can cause adverse physical interactions. Doctors frequently prescribe specific antidepressants or anti-nausea drugs to help patients manage migraine symptoms. Some of these pharmaceuticals can inadvertently trigger or exacerbate the uncomfortable physical sensations associated with restless legs syndrome.
The reverse medical reaction is also true in many hospital settings. Dopamine agonists are a specific class of drugs standardly used to calm limb movements in patients with movement disorders. If given to someone with a history of migraines, these same medications can provoke severe headache episodes. The researchers suggest that clinicians screen migraine patients for sleep disorders before finalizing a pharmaceutical protocol.
If a patient suffers from both conditions, doctors may need to pivot to alternative medications, such as specific anticonvulsant drugs, that can simultaneously soothe irritated nerves without aggravating either disorder. The study authors also advise non-pharmacological interventions, including strict sleep hygiene protocols, psychological therapies, and regular physical exercise. These lifestyle modifications can improve sleep efficiency and lift depressive symptoms without the risk of dangerous drug interactions.
The researchers outlined a few limitations in the available clinical data. The 30 studies utilized varying diagnostic questionnaires to identify sleep disorders, which introduced a high degree of statistical heterogeneity into the final results. Very few past studies have categorized patients using the most updated international criteria for headache disorders.
Future research should incorporate modern imaging techniques to observe the brains of patients experiencing both conditions simultaneously. Tracking iron levels, dopamine receptor activity, and the brain’s electrical excitability over a longer time horizon could isolate the precise biological origin point of this overlap. By tracking these variables over several years, scientists hope to develop targeted therapies that soothe the nervous system entirely.
The study, “Migraine and Restless Legs Syndrome: A Meta-Analysis,” was authored by Florindo d’Onofrio, Maria Cropano, Giada Panzino, Mariachiara Gaita, Giulio Cicarelli, Piero Barbanti, Gerardo Casucci, Simona Raimo, and Antonio Costanzo.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #MigraineAndRestlessLegs #MigrainesWithAura #RestlessLegsSyndrome #SleepDisorders #ChronicMigraine #DAdopamine #IronMetabolism #SleepHygiene #MentalHealthAwareness #NeuroScienceResearch
-
Weekly yoga practice improves sleep and well-being in cancer survivors
FDA fast-tracks pancreatic cancer drug daraxonrasib Family and emergency medicine physician Dr. Janette Nesheiwat discusses how artificial intelligence…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #breastcancer #cancer #fitnessandwellbeing #sleepdisorders #stressandanxiety
https://www.newsbeep.com/us/679842/ -
Weekly yoga practice improves sleep and well-being in cancer survivors
FDA fast-tracks pancreatic cancer drug daraxonrasib Family and emergency medicine physician Dr. Janette Nesheiwat discusses how artificial intelligence…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #breastcancer #cancer #fitnessandwellbeing #sleepdisorders #stressandanxiety
https://www.newsbeep.com/us/679842/ -
Many people wake feeling groggy after a night of vivid dreams, but it’s not the dreaming that’s draining your energy. https://english.mathrubhumi.com/lifestyle/dreams-and-morning-fatigue-explained-xfm6fk2u?utm_source=dlvr.it&utm_medium=mastodon #Dreams #Sleep #MentalHealth #SleepDisorders
-
Many people wake feeling groggy after a night of vivid dreams, but it’s not the dreaming that’s draining your energy. https://english.mathrubhumi.com/lifestyle/dreams-and-morning-fatigue-explained-xfm6fk2u?utm_source=dlvr.it&utm_medium=mastodon #Dreams #Sleep #MentalHealth #SleepDisorders
-
Many people wake feeling groggy after a night of vivid dreams, but it’s not the dreaming that’s draining your energy. https://english.mathrubhumi.com/lifestyle/dreams-and-morning-fatigue-explained-xfm6fk2u?utm_source=dlvr.it&utm_medium=mastodon #Dreams #Sleep #MentalHealth #SleepDisorders
-
Many people wake feeling groggy after a night of vivid dreams, but it’s not the dreaming that’s draining your energy. https://english.mathrubhumi.com/lifestyle/dreams-and-morning-fatigue-explained-xfm6fk2u?utm_source=dlvr.it&utm_medium=mastodon #Dreams #Sleep #MentalHealth #SleepDisorders
-
I've found that using Valerian root for those 3-4 hours of remaining sleep puts me into a deeper sleep and I am actually semi-rested the next day, instead of coffee filled zombie.
-
I've found that using Valerian root for those 3-4 hours of remaining sleep puts me into a deeper sleep and I am actually semi-rested the next day, instead of coffee filled zombie.
-
I've found that using Valerian root for those 3-4 hours of remaining sleep puts me into a deeper sleep and I am actually semi-rested the next day, instead of coffee filled zombie.
-
Sleep Disturbances Signal Potential Dementia Risk
Experts say bad sleep, like insomnia or daytime sleepiness, can be an early sign of dementia. Learn why sleep matters for brain health.
#SleepAndDementia, #AlzheimersAwareness, #BrainHealth, #SleepDisorders, #DementiaRisk
-
New research shows that poor sleep quality is linked to brain changes seen in dementia. About 15% of older adults with worse sleep developed dementia.
#SleepAndDementia, #AlzheimersAwareness, #BrainHealth, #SleepDisorders, #DementiaRisk
https://newsletter.tf/poor-sleep-early-dementia-signs/ -
📄 In #JCPPA: Genetic and environmental influences on sleep quality, ability to settle, and crying duration in 2‐ and 5‐month‐old infants: A longitudinal twin study
👉 https://doi.org/10.1002/jcv2.70023
#MentalHealthResearch #Autism #SleepDisorders -
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Poor sleep may raise Alzheimer’s risk by blocking brain’s ability to flush toxins
NEWYou can now listen to Fox News articles! There’s a known link between sleep and brain health –…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #alzheimers #brainhealth #Medicalresearch #sleepdisorders #stressandanxiety
https://www.newsbeep.com/us/571637/ -
Poor sleep may raise Alzheimer’s risk by blocking brain’s ability to flush toxins
NEWYou can now listen to Fox News articles! There’s a known link between sleep and brain health –…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #alzheimers #brainhealth #Medicalresearch #sleepdisorders #stressandanxiety
https://www.newsbeep.com/us/571637/ -
https://www.europesays.com/ie/398855/ Why you still feel tired after 8 hours of sleep, according to an expert #Éire #Health #HealthyLiving #IE #Ireland #lifestyle #Men'sHealth #SleepDisorders #wellness #Women'sHealth
-
“We know in the period after you're active and get exercise, you can focus and make fewer errors.”
👉 Watch on ACAMH Learn · Free CPD/CME
#ChildMentalHealth #EvidenceBased #ADHD #SleepDisorders -
Melatonin Vs. Magnesium for Sleep: Experts Reveal Which Works Better
Melatonin Vs. Magnesium for Sleep: Which Is Best? Westend61 – Getty Images “Hearst Magazines and Yahoo may earn…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #Dr.Lee #KennethLee #melatoninforsleep #sleepdisorders
https://www.newsbeep.com/us/517289/ -
Melatonin Vs. Magnesium for Sleep: Experts Reveal Which Works Better
Melatonin Vs. Magnesium for Sleep: Which Is Best? Westend61 – Getty Images “Hearst Magazines and Yahoo may earn…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #Dr.Lee #KennethLee #melatoninforsleep #sleepdisorders
https://www.newsbeep.com/us/517289/ -
Melatonin Vs. Magnesium for Sleep: Experts Reveal Which Works Better
Melatonin Vs. Magnesium for Sleep: Which Is Best? Westend61 – Getty Images “Hearst Magazines and Yahoo may earn…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #Dr.Lee #KennethLee #melatoninforsleep #sleepdisorders
https://www.newsbeep.com/us/516488/ -
Melatonin Vs. Magnesium for Sleep: Experts Reveal Which Works Better
Melatonin Vs. Magnesium for Sleep: Which Is Best? Westend61 – Getty Images “Hearst Magazines and Yahoo may earn…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #Dr.Lee #KennethLee #melatoninforsleep #sleepdisorders
https://www.newsbeep.com/us/516488/ -
Valerian root compared to Valium for anti-anxiety, while experts warn of risks
NEWYou can now listen to Fox News articles! Valerian, an herbal supplement long used for sleep and relaxation,…
#NewsBeep #News #Medication #Alternativemedicine #AU #Australia #Health #Lifestyle #medications #sleepdisorders #stressandanxiety #vitaminssupplements
https://www.newsbeep.com/au/528037/ -
Valerian root compared to Valium for anti-anxiety, while experts warn of risks
NEWYou can now listen to Fox News articles! Valerian, an herbal supplement long used for sleep and relaxation,…
#NewsBeep #News #Medication #Alternativemedicine #AU #Australia #Health #Lifestyle #medications #sleepdisorders #stressandanxiety #vitaminssupplements
https://www.newsbeep.com/au/528037/ -
https://www.europesays.com/ie/375191/ Valerian root compared to Valium for anti-anxiety, while experts warn of risks #AlternativeMedicine #Éire #Health #IE #Ireland #lifestyle #Medication #Medications #SleepDisorders #StressAndAnxiety #VitaminsSupplements
-
https://www.europesays.com/uk/812490/ Valerian root compared to Valium for anti-anxiety, while experts warn of risks #AlternativeMedicine #Health #Lifestyle #medications #MentalHealth #SleepDisorders #StressAndAnxiety #UK #UnitedKingdom #VitaminsSupplements
-
Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia
Modern science is just catching up to what folk and traditional healers have known since Homeric times. While…
#NewsBeep #News #Medication #Anxiety #AU #Australia #depression #Health #Mentalhealth #Sleep #sleepdisorders #sleeping #stress #supplements #wellness
https://www.newsbeep.com/au/507728/ -
Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia
Modern science is just catching up to what folk and traditional healers have known since Homeric times. While…
#NewsBeep #News #Medication #Anxiety #AU #Australia #depression #Health #Mentalhealth #Sleep #sleepdisorders #sleeping #stress #supplements #wellness
https://www.newsbeep.com/au/507728/ -
Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia
Modern science is just catching up to what folk and traditional healers have known since Homeric times. While…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Medication #anxiety #depression #Health #Mentalhealth #Sleep #sleepdisorders #sleeping #stress #supplements #wellness
https://www.newsbeep.com/us/493794/ -
Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia
Modern science is just catching up to what folk and traditional healers have known since Homeric times. While…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Medication #anxiety #depression #Health #Mentalhealth #Sleep #sleepdisorders #sleeping #stress #supplements #wellness
https://www.newsbeep.com/us/493794/ -
https://www.europesays.com/uk/792676/ Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia #anxiety #Depression #Health #Medication #MentalHealth #Sleep #SleepDisorders #sleeping #Stress #supplements #UK #UnitedKingdom #Wellness
-
https://www.europesays.com/ie/359166/ Plant called ‘nature’s Valium’ can help with anxiety, stress, insomnia #anxiety #Depression #Éire #Health #IE #Ireland #Medication #MentalHealth #Sleep #SleepDisorders #sleeping #Stress #supplements #wellness
-
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
Sleep disorders affect millions worldwide. They can cause insomnia, restless nights, frequent waking, and daytime fatigue. Treating sleep disorders with good habits, therapy, or medical help improves health and mood. 💛
اضطرابات النوم تؤثر على الملايين حول العالم. تشمل الأرق، الليالي المضطربة، الاستيقاظ المتكرر، والتعب النهاري. علاج اضطرابات النوم بالعادات الصحيحة، العلاج النفسي، أو المساعدة الطبية يحسن الصحة والمزاج. 💛
#SleepDisorders #MentalHealth #Health #SelfCare #Insomnia #Therapy #النوم -
New ‘smart drug’ could beat jet lag in half the time: study
Woke up in a new time zone, but your brain stayed home? You’re not alone. Each year, more…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Medication #experimentaldrugs #Genetics #Health #medicalbreakthroughs #medicine #sleepdisorders #sleeptips #studysays #travel #wellness
https://www.newsbeep.com/us/451267/