#genetics — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #genetics, aggregated by home.social.
-
Ever wonder why China, Korea, and Japan share similar physical features? Here’s a great breakdown with actual scientific backing. 🌏 https://youtu.be/Ce7f0rxxZeE?si=LL4Ya5iRce6bl46c
-
Ever wonder why China, Korea, and Japan share similar physical features? Here’s a great breakdown with actual scientific backing. 🌏 https://youtu.be/Ce7f0rxxZeE?si=LL4Ya5iRce6bl46c
-
Ever wonder why China, Korea, and Japan share similar physical features? Here’s a great breakdown with actual scientific backing. 🌏 https://youtu.be/Ce7f0rxxZeE?si=LL4Ya5iRce6bl46c
-
Ever wonder why China, Korea, and Japan share similar physical features? Here’s a great breakdown with actual scientific backing. 🌏 https://youtu.be/Ce7f0rxxZeE?si=LL4Ya5iRce6bl46c
-
Ever wonder why China, Korea, and Japan share similar physical features? Here’s a great breakdown with actual scientific backing. 🌏 https://youtu.be/Ce7f0rxxZeE?si=LL4Ya5iRce6bl46c
-
New student orientation 🎉🧬
Ten new students have started their graduate studies in the Drexel MCBG Graduate Program 😊
Welcome to MCBG🤩#GraduateSchool #BiomedicalScience #MolecularBiology #CellBiology #Genetics
-
New student orientation 🎉🧬
Ten new students have started their graduate studies in the Drexel MCBG Graduate Program 😊
Welcome to MCBG🤩#GraduateSchool #BiomedicalScience #MolecularBiology #CellBiology #Genetics
-
New student orientation 🎉🧬
Ten new students have started their graduate studies in the Drexel MCBG Graduate Program 😊
Welcome to MCBG🤩#GraduateSchool #BiomedicalScience #MolecularBiology #CellBiology #Genetics
-
New student orientation 🎉🧬
Ten new students have started their graduate studies in the Drexel MCBG Graduate Program 😊
Welcome to MCBG🤩#GraduateSchool #BiomedicalScience #MolecularBiology #CellBiology #Genetics
-
New student orientation 🎉🧬
Ten new students have started their graduate studies in the Drexel MCBG Graduate Program 😊
Welcome to MCBG🤩#GraduateSchool #BiomedicalScience #MolecularBiology #CellBiology #Genetics
-
However, the fibromyalgia GWAS study* used a technique that tied other variants associated with fibromyalgia to the central nervous system - eQTL (expression Quantitative Trait Locus) analysis.
To be fair, this seems less prone to bias than simply designating certain genes to be 'brain genes' since they are associated with 'brain diseases'.
I'm still skeptical, given my own experience with fibromyalgia - though it is possible that I don't actually have fibromyalgia, but instead have an autoinflammatory condition that is driven by NLRP3 inflammasome activation caused by being a familial Mediterranean fever gene (mutant MEFV) carrier.
On the other hand, my symptoms closely match those of fibromyalgia, and I see myself in fibromyalgia patient stories. I have allergies, eczema, and asthma - which are common comorbidities**. And like many people with fibromyalgia, I have found symptom relief through the elimination of dietary triggers*** and treatments that target the immune system.
* https://doi.org/10.1038/s41591-026-04492-6
** https://pubmed.ncbi.nlm.nih.gov/40011987/
*** for me, these include items that are considered to be 'healthy', such as sunflower seeds
3/3
-
However, the fibromyalgia GWAS study* used a technique that tied other variants associated with fibromyalgia to the central nervous system - eQTL (expression Quantitative Trait Locus) analysis.
To be fair, this seems less prone to bias than simply designating certain genes to be 'brain genes' since they are associated with 'brain diseases'.
I'm still skeptical, given my own experience with fibromyalgia - though it is possible that I don't actually have fibromyalgia, but instead have an autoinflammatory condition that is driven by NLRP3 inflammasome activation caused by being a familial Mediterranean fever gene (mutant MEFV) carrier.
On the other hand, my symptoms closely match those of fibromyalgia, and I see myself in fibromyalgia patient stories. I have allergies, eczema, and asthma - which are common comorbidities**. And like many people with fibromyalgia, I have found symptom relief through the elimination of dietary triggers*** and treatments that target the immune system.
* https://doi.org/10.1038/s41591-026-04492-6
** https://pubmed.ncbi.nlm.nih.gov/40011987/
*** for me, these include items that are considered to be 'healthy', such as sunflower seeds
3/3
-
However, the fibromyalgia GWAS study* used a technique that tied other variants associated with fibromyalgia to the central nervous system - eQTL (expression Quantitative Trait Locus) analysis.
To be fair, this seems less prone to bias than simply designating certain genes to be 'brain genes' since they are associated with 'brain diseases'.
I'm still skeptical, given my own experience with fibromyalgia - though it is possible that I don't actually have fibromyalgia, but instead have an autoinflammatory condition that is driven by NLRP3 inflammasome activation caused by being a familial Mediterranean fever gene (mutant MEFV) carrier.
On the other hand, my symptoms closely match those of fibromyalgia, and I see myself in fibromyalgia patient stories. I have allergies, eczema, and asthma - which are common comorbidities**. And like many people with fibromyalgia, I have found symptom relief through the elimination of dietary triggers*** and treatments that target the immune system.
* https://doi.org/10.1038/s41591-026-04492-6
** https://pubmed.ncbi.nlm.nih.gov/40011987/
*** for me, these include items that are considered to be 'healthy', such as sunflower seeds
3/3
-
However, the fibromyalgia GWAS study* used a technique that tied other variants associated with fibromyalgia to the central nervous system - eQTL (expression Quantitative Trait Locus) analysis.
To be fair, this seems less prone to bias than simply designating certain genes to be 'brain genes' since they are associated with 'brain diseases'.
I'm still skeptical, given my own experience with fibromyalgia - though it is possible that I don't actually have fibromyalgia, but instead have an autoinflammatory condition that is driven by NLRP3 inflammasome activation caused by being a familial Mediterranean fever gene (mutant MEFV) carrier.
On the other hand, my symptoms closely match those of fibromyalgia, and I see myself in fibromyalgia patient stories. I have allergies, eczema, and asthma - which are common comorbidities**. And like many people with fibromyalgia, I have found symptom relief through the elimination of dietary triggers*** and treatments that target the immune system.
* https://doi.org/10.1038/s41591-026-04492-6
** https://pubmed.ncbi.nlm.nih.gov/40011987/
*** for me, these include items that are considered to be 'healthy', such as sunflower seeds
3/3
-
The scientist mapping childhood's missing biology: gene expression data that could transform paediatric medicine
https://www.technologyreview.com/2026/08/14/1141354/deanne-taylor-gene-expression-children/
In 2017, Deanne Taylor attended a presentation at the University of Pennsylvania, just a short walk from her office. A researcher was there to unveil the Human Cell Atlas, an ambitious project that…
#mix #genetics #children -
The scientist mapping childhood's missing biology: gene expression data that could transform paediatric medicine
https://www.technologyreview.com/2026/08/14/1141354/deanne-taylor-gene-expression-children/
In 2017, Deanne Taylor attended a presentation at the University of Pennsylvania, just a short walk from her office. A researcher was there to unveil the Human Cell Atlas, an ambitious project that…
#mix #genetics #children -
In 2017, Deanne Taylor attended a presentation at the University of Pennsylvania, just a short walk from her office. A researcher was there to unveil the Human Cell Atlas, an ambitious project that… #mix #genetics #children
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
In 2017, Deanne Taylor attended a presentation at the University of Pennsylvania, just a short walk from her office. A researcher was there to unveil the Human Cell Atlas, an ambitious project that… #mix #genetics #children
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
In 2017, Deanne Taylor attended a presentation at the University of Pennsylvania, just a short walk from her office. A researcher was there to unveil the Human Cell Atlas, an ambitious project that… #mix #genetics #children
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
DATE: August 13, 2026 at 02:00PM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: Why do some children develop ADHD after stressful events while others do not?
Children exposed to stressful life events may face a greater risk of developing ADHD symptoms, but a new study suggests that vulnerability depends partly on family mental health, genetic risk, and brain development. These findings were published in the Journal of Child Psychology and Psychiatry.
ADHD is commonly associated with difficulties involving attention, impulsive behavior, and activity levels. Researchers have long known that both inherited factors and environmental experiences contribute to ADHD. Stressful events during childhood, including violence, serious accidents, or other major disruptions, may interfere with emotional development and brain systems involved in attention and self-control.
Yet exposure to stress is not a straightforward explanation for ADHD. Some children show substantial difficulties after stressful experiences, while others appear relatively resilient. The new study aimed to identify the factors that might explain these differences.
Led by Seung Yun Choi of Seoul National University, the research team examined data from the Adolescent Brain Cognitive Development study. The initial group included 6,303 children, 46.8 percent of whom were female, aged approximately 9.9 years at the beginning of the study. The children were assessed again after one year and two years.
The researchers considered several types of information, including ADHD symptoms, stressful life events, parental mental health difficulties, genetic measures, and connections between brain regions. Choi and colleagues then utilized a machine-learning approach, an advanced form of data analysis, to examine the complex relationships between these factors.
The results revealed that stressful experiences were associated with increased ADHD symptoms at both follow-up points. However, the size of this association varied considerably between children. At the one-year follow-up, children considered most vulnerable had higher levels of parental depression and parental ADHD. They also differed from lower-risk children on a genetic measure related to smoking behavior.
By the two-year follow-up, parental mental health problems remained important, and a higher genetic risk score for ADHD also became a significant factor. The researchers also identified differences in the physical connections between parts of the brain involved in planning, attention, and behavioral control.
The contrast between the groups was substantial. At one year, the estimated effect of stressful events was more than twice as large in the highest-risk group as in the lowest-risk group. A similar pattern was observed after two years.
The authors emphasized that their findings “underscore the importance of integrating environmental, genetic, and neural variables to identify children vulnerable or resilient to developing ADHD symptoms following early-life stress.”
The findings do not mean that genes determine whether a child will develop ADHD, nor that family mental health difficulties inevitably lead to symptoms. Instead, they suggest that children may differ in how strongly they respond to stressful environments. Family support, early assistance, and treatment for parental mental health problems could therefore be important parts of prevention.
The study has several limitations. For instance, the definition of stressful life events the authors utilized is based on the level of exposure, which may not adequately capture the subjective intensity of these experiences.
The study, “Individual differences in effects of stressful life events on childhood ADHD: genetic, neural, and familial contributions,” was authored by Seung Yun Choi, Jinwoo Lee, Junghoon Park, Eunji Lee, Bo-Gyeom Kim, Gakyung Kim, Yoonjung Yoonie Joo, and Jiook Cha.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #ADHD #ChildDevelopment #StressAndADHD #FamilyMentalHealth #Genetics #NeuralDevelopment #BrainConnections #AdolescentBrainCognition #MentalHealthAwareness #EarlyIntervention
-
DATE: August 13, 2026 at 02:00PM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: Why do some children develop ADHD after stressful events while others do not?
Children exposed to stressful life events may face a greater risk of developing ADHD symptoms, but a new study suggests that vulnerability depends partly on family mental health, genetic risk, and brain development. These findings were published in the Journal of Child Psychology and Psychiatry.
ADHD is commonly associated with difficulties involving attention, impulsive behavior, and activity levels. Researchers have long known that both inherited factors and environmental experiences contribute to ADHD. Stressful events during childhood, including violence, serious accidents, or other major disruptions, may interfere with emotional development and brain systems involved in attention and self-control.
Yet exposure to stress is not a straightforward explanation for ADHD. Some children show substantial difficulties after stressful experiences, while others appear relatively resilient. The new study aimed to identify the factors that might explain these differences.
Led by Seung Yun Choi of Seoul National University, the research team examined data from the Adolescent Brain Cognitive Development study. The initial group included 6,303 children, 46.8 percent of whom were female, aged approximately 9.9 years at the beginning of the study. The children were assessed again after one year and two years.
The researchers considered several types of information, including ADHD symptoms, stressful life events, parental mental health difficulties, genetic measures, and connections between brain regions. Choi and colleagues then utilized a machine-learning approach, an advanced form of data analysis, to examine the complex relationships between these factors.
The results revealed that stressful experiences were associated with increased ADHD symptoms at both follow-up points. However, the size of this association varied considerably between children. At the one-year follow-up, children considered most vulnerable had higher levels of parental depression and parental ADHD. They also differed from lower-risk children on a genetic measure related to smoking behavior.
By the two-year follow-up, parental mental health problems remained important, and a higher genetic risk score for ADHD also became a significant factor. The researchers also identified differences in the physical connections between parts of the brain involved in planning, attention, and behavioral control.
The contrast between the groups was substantial. At one year, the estimated effect of stressful events was more than twice as large in the highest-risk group as in the lowest-risk group. A similar pattern was observed after two years.
The authors emphasized that their findings “underscore the importance of integrating environmental, genetic, and neural variables to identify children vulnerable or resilient to developing ADHD symptoms following early-life stress.”
The findings do not mean that genes determine whether a child will develop ADHD, nor that family mental health difficulties inevitably lead to symptoms. Instead, they suggest that children may differ in how strongly they respond to stressful environments. Family support, early assistance, and treatment for parental mental health problems could therefore be important parts of prevention.
The study has several limitations. For instance, the definition of stressful life events the authors utilized is based on the level of exposure, which may not adequately capture the subjective intensity of these experiences.
The study, “Individual differences in effects of stressful life events on childhood ADHD: genetic, neural, and familial contributions,” was authored by Seung Yun Choi, Jinwoo Lee, Junghoon Park, Eunji Lee, Bo-Gyeom Kim, Gakyung Kim, Yoonjung Yoonie Joo, and Jiook Cha.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #ADHD #ChildDevelopment #StressAndADHD #FamilyMentalHealth #Genetics #NeuralDevelopment #BrainConnections #AdolescentBrainCognition #MentalHealthAwareness #EarlyIntervention
-
DATE: August 13, 2026 at 02:00PM
SOURCE: PSYPOST.ORG** Research quality varies widely from fantastic to small exploratory studies. Please check research methods when conclusions are very important to you. **
-------------------------------------------------TITLE: Why do some children develop ADHD after stressful events while others do not?
Children exposed to stressful life events may face a greater risk of developing ADHD symptoms, but a new study suggests that vulnerability depends partly on family mental health, genetic risk, and brain development. These findings were published in the Journal of Child Psychology and Psychiatry.
ADHD is commonly associated with difficulties involving attention, impulsive behavior, and activity levels. Researchers have long known that both inherited factors and environmental experiences contribute to ADHD. Stressful events during childhood, including violence, serious accidents, or other major disruptions, may interfere with emotional development and brain systems involved in attention and self-control.
Yet exposure to stress is not a straightforward explanation for ADHD. Some children show substantial difficulties after stressful experiences, while others appear relatively resilient. The new study aimed to identify the factors that might explain these differences.
Led by Seung Yun Choi of Seoul National University, the research team examined data from the Adolescent Brain Cognitive Development study. The initial group included 6,303 children, 46.8 percent of whom were female, aged approximately 9.9 years at the beginning of the study. The children were assessed again after one year and two years.
The researchers considered several types of information, including ADHD symptoms, stressful life events, parental mental health difficulties, genetic measures, and connections between brain regions. Choi and colleagues then utilized a machine-learning approach, an advanced form of data analysis, to examine the complex relationships between these factors.
The results revealed that stressful experiences were associated with increased ADHD symptoms at both follow-up points. However, the size of this association varied considerably between children. At the one-year follow-up, children considered most vulnerable had higher levels of parental depression and parental ADHD. They also differed from lower-risk children on a genetic measure related to smoking behavior.
By the two-year follow-up, parental mental health problems remained important, and a higher genetic risk score for ADHD also became a significant factor. The researchers also identified differences in the physical connections between parts of the brain involved in planning, attention, and behavioral control.
The contrast between the groups was substantial. At one year, the estimated effect of stressful events was more than twice as large in the highest-risk group as in the lowest-risk group. A similar pattern was observed after two years.
The authors emphasized that their findings “underscore the importance of integrating environmental, genetic, and neural variables to identify children vulnerable or resilient to developing ADHD symptoms following early-life stress.”
The findings do not mean that genes determine whether a child will develop ADHD, nor that family mental health difficulties inevitably lead to symptoms. Instead, they suggest that children may differ in how strongly they respond to stressful environments. Family support, early assistance, and treatment for parental mental health problems could therefore be important parts of prevention.
The study has several limitations. For instance, the definition of stressful life events the authors utilized is based on the level of exposure, which may not adequately capture the subjective intensity of these experiences.
The study, “Individual differences in effects of stressful life events on childhood ADHD: genetic, neural, and familial contributions,” was authored by Seung Yun Choi, Jinwoo Lee, Junghoon Park, Eunji Lee, Bo-Gyeom Kim, Gakyung Kim, Yoonjung Yoonie Joo, and Jiook Cha.
-------------------------------------------------
Private, vetted email list for mental health professionals: https://www.clinicians-exchange.org
Unofficial Psychology Today Xitter to toot feed at Psych Today Unofficial Bot @PTUnofficialBot
-------------------------------------------------
#psychology #counseling #socialwork #psychotherapy @psychotherapist @psychotherapists @psychology @socialpsych @socialwork @psychiatry #mentalhealth #psychiatry #healthcare #depression #psychotherapist #ADHD #ChildDevelopment #StressAndADHD #FamilyMentalHealth #Genetics #NeuralDevelopment #BrainConnections #AdolescentBrainCognition #MentalHealthAwareness #EarlyIntervention
-
#Genetics
#Genomics
#Bioinformatics
#AcademiaHive mind: we're revamping a journal club course that has used the same stack of papers for a very long time. I have some favorites I'm listing as candidates.
If you have suggestions for papers, fire 'em at me. It's second year grad students with focuses in molecular genetics and genomics. Anything spanning across genetics, genomics, and computational biology are contenders.
Looking for neat concepts, designs, cool findings, etc etc to dissect
-
#Genetics
#Genomics
#Bioinformatics
#AcademiaHive mind: we're revamping a journal club course that has used the same stack of papers for a very long time. I have some favorites I'm listing as candidates.
If you have suggestions for papers, fire 'em at me. It's second year grad students with focuses in molecular genetics and genomics. Anything spanning across genetics, genomics, and computational biology are contenders.
Looking for neat concepts, designs, cool findings, etc etc to dissect
-
#Genetics
#Genomics
#Bioinformatics
#AcademiaHive mind: we're revamping a journal club course that has used the same stack of papers for a very long time. I have some favorites I'm listing as candidates.
If you have suggestions for papers, fire 'em at me. It's second year grad students with focuses in molecular genetics and genomics. Anything spanning across genetics, genomics, and computational biology are contenders.
Looking for neat concepts, designs, cool findings, etc etc to dissect
-
#Genetics
#Genomics
#Bioinformatics
#AcademiaHive mind: we're revamping a journal club course that has used the same stack of papers for a very long time. I have some favorites I'm listing as candidates.
If you have suggestions for papers, fire 'em at me. It's second year grad students with focuses in molecular genetics and genomics. Anything spanning across genetics, genomics, and computational biology are contenders.
Looking for neat concepts, designs, cool findings, etc etc to dissect
-
#Genetics
#Genomics
#Bioinformatics
#AcademiaHive mind: we're revamping a journal club course that has used the same stack of papers for a very long time. I have some favorites I'm listing as candidates.
If you have suggestions for papers, fire 'em at me. It's second year grad students with focuses in molecular genetics and genomics. Anything spanning across genetics, genomics, and computational biology are contenders.
Looking for neat concepts, designs, cool findings, etc etc to dissect
-
Scientists use CRISPR to remove the Y chromosome and turn male mouse embryos into females — a world first
https://www.technologyreview.com/2026/08/12/1141768/scientists-just-created-female-clones-of-male-mice/
Scientists have deliberately turned male mouse embryos into females for the first time. A team based in Japan used a CRISPR-based approach to remove the Y chromosome from male cells and create female…
#mix #genetics #crispr -
Scientists use CRISPR to remove the Y chromosome and turn male mouse embryos into females — a world first
https://www.technologyreview.com/2026/08/12/1141768/scientists-just-created-female-clones-of-male-mice/
Scientists have deliberately turned male mouse embryos into females for the first time. A team based in Japan used a CRISPR-based approach to remove the Y chromosome from male cells and create female…
#mix #genetics #crispr -
Scientists have deliberately turned male mouse embryos into females for the first time. A team based in Japan used a CRISPR-based approach to remove the Y chromosome from male cells and create female… #mix #genetics #crispr
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
Scientists have deliberately turned male mouse embryos into females for the first time. A team based in Japan used a CRISPR-based approach to remove the Y chromosome from male cells and create female… #mix #genetics #crispr
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
Scientists have deliberately turned male mouse embryos into females for the first time. A team based in Japan used a CRISPR-based approach to remove the Y chromosome from male cells and create female… #mix #genetics #crispr
Posted into FLIPBOARD EXCHANGE FEED 🗞️ @flipboard-exchange-feed-Econopass
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Crazy Sleep Syndrome: Genetics vs. Night Owls
Uncover the secrets of sleep! Join our captivating podcast discussion on sleep patterns, internal clocks, and the fascinating familial advanced sleep phase syndrome. Discover how genetics and lifestyle impact our sleep.
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
-
Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study
The present exploratory pilot st…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Fitness #athletes #diseases #Exerciseaddiction #Gene #Genetics #Genome-wideassociationstudy(GWAS) #Health #HumanitiesandSocialSciences #Medicalresearch #multidisciplinary #Polymorphisms #Riskfactors #Science #Sportgenetics
https://www.newsbeep.com/us/811694/ -
Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study
The present exploratory pilot st…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Fitness #athletes #diseases #Exerciseaddiction #Gene #Genetics #Genome-wideassociationstudy(GWAS) #Health #HumanitiesandSocialSciences #Medicalresearch #multidisciplinary #Polymorphisms #Riskfactors #Science #Sportgenetics
https://www.newsbeep.com/us/811694/ -
https://www.europesays.com/uk/1145052/ Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study #athletes #Diseases #ExerciseAddiction #Fitness #Gene #Genetics #GenomeWideAssociationStudy(GWAS) #Health #HumanitiesAndSocialSciences #MedicalResearch #multidisciplinary #Polymorphisms #RiskFactors #Science #SportGenetics #UK #UnitedKingdom
-
Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study
The present exploratory pilot study investigated genetic varian…
#NewsBeep #News #Fitness #athletes #AU #Australia #Diseases #Exerciseaddiction #Gene #Genetics #Genome-wideassociationstudy(GWAS) #Health #HumanitiesandSocialSciences #MedicalResearch #multidisciplinary #Polymorphisms #Riskfactors #Science #Sportgenetics
https://www.newsbeep.com/au/852931/ -
Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study
The present exploratory pilot study investigated genetic varian…
#NewsBeep #News #Fitness #athletes #AU #Australia #Diseases #Exerciseaddiction #Gene #Genetics #Genome-wideassociationstudy(GWAS) #Health #HumanitiesandSocialSciences #MedicalResearch #multidisciplinary #Polymorphisms #Riskfactors #Science #Sportgenetics
https://www.newsbeep.com/au/852931/ -
https://www.europesays.com/ie/633845/ AI-based methods help uncover hidden roots of tumor metastasis #ArtificialIntelligence #cancer #CancerTherapy #Cell #DigitalPathology #Éire #Genes #Genetic #Genetics #Health #IE #Ireland #MachineLearning #Melanoma #Metastasis #Pathology #Protein #Proteomics #Research #therapy #Transcriptomics #Tumor
-
Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study
The present exploratory pilot study investigated genetic va…
#NewsBeep #News #Fitness #athletes #diseases #Exerciseaddiction #Gene #Genetics #Genome-wideassociationstudy(GWAS) #Health #HumanitiesandSocialSciences #medicalresearch #multidisciplinary #Polymorphisms #Riskfactors #Science #Sportgenetics #UK #UnitedKingdom
https://www.newsbeep.com/uk/735915/ -
https://www.europesays.com/ie/633663/ Possible relationship between genetic polymorphisms and the risk of exercise addiction among Turkish elite athletes: an exploratory pilot study #athletes #Diseases #Éire #ExerciseAddiction #Fitness #Gene #Genetics #GenomeWideAssociationStudy(GWAS) #Health #HumanitiesAndSocialSciences #IE #Ireland #MedicalResearch #multidisciplinary #Polymorphisms #RiskFactors #Science #SportGenetics
-
It's always cool to see innovative ways of using human genetics data to learn new things about disease biology, but in this case it's especially cool to see a new role in lung inflammatory disease for stearoyl-CoA desaturase, a protein I studied 20 years ago!
Salamone IM, Tian P, Qi Z, Zhao J, Zhang L, Tan Q, et al. Trans-regulatory gene mapping prioritizes disease drivers in asthma. Cell 2026. https://doi.org/10.1016/j.cell.2026.07.034
-
It's always cool to see innovative ways of using human genetics data to learn new things about disease biology, but in this case it's especially cool to see a new role in lung inflammatory disease for stearoyl-CoA desaturase, a protein I studied 20 years ago!
Salamone IM, Tian P, Qi Z, Zhao J, Zhang L, Tan Q, et al. Trans-regulatory gene mapping prioritizes disease drivers in asthma. Cell 2026. https://doi.org/10.1016/j.cell.2026.07.034
-
It's always cool to see innovative ways of using human genetics data to learn new things about disease biology, but in this case it's especially cool to see a new role in lung inflammatory disease for stearoyl-CoA desaturase, a protein I studied 20 years ago!
Salamone IM, Tian P, Qi Z, Zhao J, Zhang L, Tan Q, et al. Trans-regulatory gene mapping prioritizes disease drivers in asthma. Cell 2026. https://doi.org/10.1016/j.cell.2026.07.034
-
It's always cool to see innovative ways of using human genetics data to learn new things about disease biology, but in this case it's especially cool to see a new role in lung inflammatory disease for stearoyl-CoA desaturase, a protein I studied 20 years ago!
Salamone IM, Tian P, Qi Z, Zhao J, Zhang L, Tan Q, et al. Trans-regulatory gene mapping prioritizes disease drivers in asthma. Cell 2026. https://doi.org/10.1016/j.cell.2026.07.034
-
It's always cool to see innovative ways of using human genetics data to learn new things about disease biology, but in this case it's especially cool to see a new role in lung inflammatory disease for stearoyl-CoA desaturase, a protein I studied 20 years ago!
Salamone IM, Tian P, Qi Z, Zhao J, Zhang L, Tan Q, et al. Trans-regulatory gene mapping prioritizes disease drivers in asthma. Cell 2026. https://doi.org/10.1016/j.cell.2026.07.034
-
Not every DNA mistake gets fixed. We know that; that's how mutations enter the gene pool. But it gets more interesting to look at what does get fixed, because repair enzymes apparently have a priority list.
-
Not every DNA mistake gets fixed. We know that; that's how mutations enter the gene pool. But it gets more interesting to look at what does get fixed, because repair enzymes apparently have a priority list.
-
Not every DNA mistake gets fixed. We know that; that's how mutations enter the gene pool. But it gets more interesting to look at what does get fixed, because repair enzymes apparently have a priority list.
-
Not every DNA mistake gets fixed. We know that; that's how mutations enter the gene pool. But it gets more interesting to look at what does get fixed, because repair enzymes apparently have a priority list.
-
Not every DNA mistake gets fixed. We know that; that's how mutations enter the gene pool. But it gets more interesting to look at what does get fixed, because repair enzymes apparently have a priority list.
-
Phillip Island penguins to be vaccinated for bird flu
By Peter de Kruijff and Judd BoazThe targeted vaccination of 5,000 penguins is claimed to be the largest wild bird vaccination program undertaken globally.
#AvianInfluenza #ScienceandTechnology #Genetics #Birds #Conservation #Animals #Environment #PeterdeKruijff #JuddBoaz
-
Phillip Island penguins to be vaccinated for bird flu
By Peter de Kruijff and Judd BoazThe targeted vaccination of 5,000 penguins is claimed to be the largest wild bird vaccination program undertaken globally.
#AvianInfluenza #ScienceandTechnology #Genetics #Birds #Conservation #Animals #Environment #PeterdeKruijff #JuddBoaz
-
Phillip Island penguins to be vaccinated for bird flu
By Peter de Kruijff and Judd BoazThe targeted vaccination of 5,000 penguins is claimed to be the largest wild bird vaccination program undertaken globally.
#AvianInfluenza #ScienceandTechnology #Genetics #Birds #Conservation #Animals #Environment #PeterdeKruijff #JuddBoaz
-
Phillip Island penguins to be vaccinated for bird flu
By Peter de Kruijff and Judd BoazThe targeted vaccination of 5,000 penguins is claimed to be the largest wild bird vaccination program undertaken globally.
#AvianInfluenza #ScienceandTechnology #Genetics #Birds #Conservation #Animals #Environment #PeterdeKruijff #JuddBoaz
-
Phillip Island penguins to be vaccinated for bird flu
By Peter de Kruijff and Judd BoazThe targeted vaccination of 5,000 penguins is claimed to be the largest wild bird vaccination program undertaken globally.
#AvianInfluenza #ScienceandTechnology #Genetics #Birds #Conservation #Animals #Environment #PeterdeKruijff #JuddBoaz