#pku — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #pku, aggregated by home.social.
-
Now is your best chance to find my *entire* ebook collection FREE or 50% off @Smashwords!
You can find all my books at https://www.smashwords.com/profile/view/PaulineO%27Connor
#SWSale2026 #Smashwords #PKU #LivingWithPKU #RedHatStories #RareDisease #LowProtein
-
Now is your best chance to find my *entire* ebook collection FREE or 50% off @Smashwords!
You can find all my books at https://www.smashwords.com/profile/view/PaulineO%27Connor
#SWSale2026 #Smashwords #PKU #LivingWithPKU #RedHatStories #RareDisease #LowProtein
-
Tomorrow my guest post goes live on @RareBeacon for #PKUDay. I talk about Navigating Adulthood with PKU, and why community voices matter.
#PKU, #PKUDay, #RareDisease, #Phenylketonuria #LivingWithPKU
-
Tomorrow my guest post goes live on @RareBeacon for #PKUDay. I talk about Navigating Adulthood with PKU, and why community voices matter.
#PKU, #PKUDay, #RareDisease, #Phenylketonuria #LivingWithPKU
-
CW: Blood
Done my months blood spots
#blood #bloodtest #pku #phenylketonuria #pcu #phenylcetonurie
-
CW: Blood
Done my months blood spots
#blood #bloodtest #pku #phenylketonuria #pcu #phenylcetonurie
-
💛 You are more than your PKU.
🌱 Maddison, 27, drifted from the PKU diet as a teen — the pressure of being "different" got too much. Now she's working her way back to it while juggling full-time work and college.
Her message: "Keep trying and keep advocating for yourself! You can do it and always ask for support when you need it."
Quick read — her full story here 👇
https://www.pigpen.page/you-are-more-than-your-pku/My thanks to Maddison for Sharing her Story
#PKU #RareDisease #YouAreMoreThanYourPKU -
💛 You are more than your PKU.
🌱 Maddison, 27, drifted from the PKU diet as a teen — the pressure of being "different" got too much. Now she's working her way back to it while juggling full-time work and college.
Her message: "Keep trying and keep advocating for yourself! You can do it and always ask for support when you need it."
Quick read — her full story here 👇
https://www.pigpen.page/you-are-more-than-your-pku/My thanks to Maddison for Sharing her Story
#PKU #RareDisease #YouAreMoreThanYourPKU -
RE: https://mastodon.online/@caoimhin/112174121072642405
So two years later, the results of the study for the PKU home testing kit in which I participated has finally been published: https://doi.org/10.1002/jimd.70187
While they try to frame things positively in the paper, looking at the numbers it seems to me that it's just a little too unreliable. My understanding is also that without some investor, they won't be able to productise it anyway.
For now it seems they are focussing on other parts of the phenyx app (https://phenyx.de/).
-
New #openaccess publication #SciPost #Physics
Two-dimensional higher-order Weyl semimetals
Lizhou Liu, Qing-Feng Sun, Ying-Tao Zhang
SciPost Phys. 20, 115 (2026)
https://scipost.org/SciPostPhys.20.4.115 -
New #openaccess publication #SciPost #Physics
Two-dimensional higher-order Weyl semimetals
Lizhou Liu, Qing-Feng Sun, Ying-Tao Zhang
SciPost Phys. 20, 115 (2026)
https://scipost.org/SciPostPhys.20.4.115 -
New #openaccess publication #SciPost #Physics
Nonpertubative many-body theory for the two-dimensional Hubbard model at low temperature: From weak to strong coupling regimes
Ruitao Xiao, Yingze Su, Junnian Xiong, Hui Li, Huaqing Huang, Dingping Li
SciPost Phys. 20, 101 (2026)
https://scipost.org/SciPostPhys.20.4.101 -
New #openaccess publication #SciPost #Physics
Nonpertubative many-body theory for the two-dimensional Hubbard model at low temperature: From weak to strong coupling regimes
Ruitao Xiao, Yingze Su, Junnian Xiong, Hui Li, Huaqing Huang, Dingping Li
SciPost Phys. 20, 101 (2026)
https://scipost.org/SciPostPhys.20.4.101 -
I've realised I haven't posted here in a while. Also, haven't posted about movies, books, or PKU.
PKU - my last result was 325umol/L, which is good news but a little higher! I did change the diet so that was kind of expected, was actually lower than expected 🤯
Movies: Watched Ready or Not 2: Here They Come. It was fine, kind of like TWKY but not quite so supernatural.
Books: How long have you got? 🤣
-
I've realised I haven't posted here in a while. Also, haven't posted about movies, books, or PKU.
PKU - my last result was 325umol/L, which is good news but a little higher! I did change the diet so that was kind of expected, was actually lower than expected 🤯
Movies: Watched Ready or Not 2: Here They Come. It was fine, kind of like TWKY but not quite so supernatural.
Books: How long have you got? 🤣
-
Navigating Life's Challenges.
Change is a constant in life. Whether it’s a global event, a personal health journey, or an unexpected disruption, we are often forced to adapt to new realities
Explore how spoon theory and ambiguous loss shape our willpower and resilience. Learn to navigate change, chronic illness, and daily energy limits with practical insights.
#SpoonTheory #MentalHealth #Resilience #PKU #BrainInjury -
Navigating Life's Challenges.
Change is a constant in life. Whether it’s a global event, a personal health journey, or an unexpected disruption, we are often forced to adapt to new realities
Explore how spoon theory and ambiguous loss shape our willpower and resilience. Learn to navigate change, chronic illness, and daily energy limits with practical insights.
#SpoonTheory #MentalHealth #Resilience #PKU #BrainInjury -
RE: https://pkutalk.com/@soheb/116188606885004550
The results for this bloodspot was 227umol/L!
My weight lifting seems to be helping quite a bit with the bloodspots! Also, I've rounded down with my exchanges, which has helped quite a bit (I rarely ever hit 2 exchanges exactly).
I'm trying to cook my own food now to cut down on visceral fat that my weighing scales report back, so next results should be interesting...
-
RE: https://pkutalk.com/@soheb/116188606885004550
The results for this bloodspot was 227umol/L!
My weight lifting seems to be helping quite a bit with the bloodspots! Also, I've rounded down with my exchanges, which has helped quite a bit (I rarely ever hit 2 exchanges exactly).
I'm trying to cook my own food now to cut down on visceral fat that my weighing scales report back, so next results should be interesting...
-
CW: Blood
Nailed it, as usual 😏
#Phenylketonuria #PKU #phenylceotnurie #pico #blood #health #nhs
-
CW: Blood
Nailed it, as usual 😏
#Phenylketonuria #PKU #phenylceotnurie #pico #blood #health #nhs
-
March PKU & Brain Health Update:
- Rare Disease Day equity report,
- PKU research, pancake recipes,
- brain injury app trials,
- and a book sale ending 7th March!
Share your story & support the community.https://www.pigpen.page/march-2026/
#pku #rarediseaseawareness #shareyourstory #phenylketonuria #braininjury
-
March PKU & Brain Health Update:
- Rare Disease Day equity report,
- PKU research, pancake recipes,
- brain injury app trials,
- and a book sale ending 7th March!
Share your story & support the community.https://www.pigpen.page/march-2026/
#pku #rarediseaseawareness #shareyourstory #phenylketonuria #braininjury
-
CW: Blood
@soheb Is this really the latest thread we had? If so, that's probably my fault, I hadn't done one in a way too long time...
Well, I finally did it today. And it was looking really good after four circles. Maybe we should trade cards, you would have good use for five circles and I seem to hit the limit at four. 🤪
-
CW: Blood
@soheb Is this really the latest thread we had? If so, that's probably my fault, I hadn't done one in a way too long time...
Well, I finally did it today. And it was looking really good after four circles. Maybe we should trade cards, you would have good use for five circles and I seem to hit the limit at four. 🤪
-
To all PKU folks - Share your story!
@poconnor has got some great PKU stories on her blog - one from yours truly 🧐 - and you can add your story into the mix as well!
Visit this link to find out more: https://www.pigpen.page/share-your-story-2/
-
To all PKU folks - Share your story!
@poconnor has got some great PKU stories on her blog - one from yours truly 🧐 - and you can add your story into the mix as well!
Visit this link to find out more: https://www.pigpen.page/share-your-story-2/
-
Your Story Matters!
For Rare disease day, people with PKU are sharing their story.
👧 Clair discusses parenting with PKU, when your child does not have PKU - and the interesting challenges she has faced.
🍫 Ifan shares his experience navigating the manosphere, and what that meant for his PKU and mental health.
📦️ Soheb wrote a series of blogs for PigPen - looking at moving home with PKU, and getting into the gym.
-
Your Story Matters!
For Rare disease day, people with PKU are sharing their story.
👧 Clair discusses parenting with PKU, when your child does not have PKU - and the interesting challenges she has faced.
🍫 Ifan shares his experience navigating the manosphere, and what that meant for his PKU and mental health.
📦️ Soheb wrote a series of blogs for PigPen - looking at moving home with PKU, and getting into the gym.
-
Good news, did a blood spot recently! Came back 226umol/L! 🥳🎉🎊
#phenylkeotnuria #PKU #Phenylcetobnurie #PKU #bloodtest #health #nhs
-
Good news, did a blood spot recently! Came back 226umol/L! 🥳🎉🎊
#phenylkeotnuria #PKU #Phenylcetobnurie #PKU #bloodtest #health #nhs
-
Getting ready for Valentine's Day - and Pancake Tuesday :)
An easy low protein recipe for reliable PKU pancakes: photos & video guides :)
Ideas for protein-free, and measured protein toppings.
https://www.pigpen.page/pku-pancakes/
#PKU #LivingwithPKU #LowProtein #LowProteinIdeas #Phenylketonuria #Pancakes
-
Getting ready for Valentine's Day - and Pancake Tuesday :)
An easy low protein recipe for reliable PKU pancakes: photos & video guides :)
Ideas for protein-free, and measured protein toppings.
https://www.pigpen.page/pku-pancakes/
#PKU #LivingwithPKU #LowProtein #LowProteinIdeas #Phenylketonuria #Pancakes
-
Monthly email on PKU, Brain, and Mental Health:
🆓 A free workshop on Living with PKU
💊 Genetic medicine, personalised treatments, and PKU
🧠 Campaigning for change in strokes and brain injury support
and 💉 What is the PKU injection (Palynziq)?
https://www.pigpen.page/february-2026/
#PKU #LivingwithPKU #Phenylketonuria #Palynziq #BrainHealth #BrainInjury #Stroke #NHS
-
Monthly email on PKU, Brain, and Mental Health:
🆓 A free workshop on Living with PKU
💊 Genetic medicine, personalised treatments, and PKU
🧠 Campaigning for change in strokes and brain injury support
and 💉 What is the PKU injection (Palynziq)?
https://www.pigpen.page/february-2026/
#PKU #LivingwithPKU #Phenylketonuria #Palynziq #BrainHealth #BrainInjury #Stroke #NHS
-
New #openaccess publication #SciPost #Physics
Current-induced re-entrant superconductivity and extreme nonreciprocal superconducting diode effect in valley-polarized systems
Yu-Chen Zhuang, Qing-Feng Sun
SciPost Phys. 20, 021 (2026)
https://scipost.org/SciPostPhys.20.1.021 -
New #openaccess publication #SciPost #Physics
Current-induced re-entrant superconductivity and extreme nonreciprocal superconducting diode effect in valley-polarized systems
Yu-Chen Zhuang, Qing-Feng Sun
SciPost Phys. 20, 021 (2026)
https://scipost.org/SciPostPhys.20.1.021 -
What is Palynziq? And why does it have so many names?
PAL. PEG-PAL. Pegvaliase. Palynziq.
If you’ve ever felt confused by PKU treatment names — you’re not alone. They all describe the same enzyme-based treatment, just from different angles.I’ve updated my blog to explain it in plain language:
💚 what the treatment is
💚 how it works
💚 where it’s available (and where it isn’t)https://www.pigpen.page/what-is-palynziq/
#PKU #LivingWithPKU #RareDiseaseCommunity #PatientInfo #Phenylketonuria
-
What is Palynziq? And why does it have so many names?
PAL. PEG-PAL. Pegvaliase. Palynziq.
If you’ve ever felt confused by PKU treatment names — you’re not alone. They all describe the same enzyme-based treatment, just from different angles.I’ve updated my blog to explain it in plain language:
💚 what the treatment is
💚 how it works
💚 where it’s available (and where it isn’t)https://www.pigpen.page/what-is-palynziq/
#PKU #LivingWithPKU #RareDiseaseCommunity #PatientInfo #Phenylketonuria
-
RE: https://pkutalk.com/@soheb/115830394945307434
I've been so busy posting about movies and books, I forgot to post some news about my PKU!
This strange attempt at blood spot gave me a result of 277umol/L!
SCORE!
#pku #phenylketonuria #pcu #phenylcetonurie #health #healthcare #nhs
-
RE: https://pkutalk.com/@soheb/115830394945307434
I've been so busy posting about movies and books, I forgot to post some news about my PKU!
This strange attempt at blood spot gave me a result of 277umol/L!
SCORE!
#pku #phenylketonuria #pcu #phenylcetonurie #health #healthcare #nhs
-
CW: Blood
Look, I tried my best.
#blood #bloodtest #health #nhs #pku #pcu #phenylketonuria #phenylcetonurie #phenylalnine
-
CW: Blood
Look, I tried my best.
#blood #bloodtest #health #nhs #pku #pcu #phenylketonuria #phenylcetonurie #phenylalnine
-
🎁 Please share with patients, clinicians, and anyone who might be catering for someone on a Low-Protein diet this Christmas
💡 Tips and links to help with a low protein Christmas or Thanksgiving. I’ve included menu suggestions & recipes, but let’s start with making the festive season friendlier to those on restricted diets.
Merry Christmas 🎄
#PKU #LowProtein #LivingWithPKU #RareDiseas #MetabolicDisorder
-
It's been a while, but I've finished my Magnus Opus
#blood #bloodspot #bloodtest #nhs #health #pku #phenylketonuria #pcu #phenylcetonurie
-
It's been a while, but I've finished my Magnus Opus
#blood #bloodspot #bloodtest #nhs #health #pku #phenylketonuria #pcu #phenylcetonurie
-
@soheb Thank you, and thank you for the post yesterday :) I did see it and missed doing my own!
Yeah, it is difficult as I worry most about access. A few years back it became clear that the UK wouldn't get the injection.
Now that the UK isn't in the EU, Sepheince isn't a guarantee - particularly for adults.
Re the kidney drugs, None of the UK trials discussed were looking at adults!
I think we and the NSPKU have to gear up for campaigning again as access is going to be a key issue!
#PKU -
🔬 The latest on PKU treatment from NSPKU's October conference - and what they might mean for those living with PKU.
💊 Sepiapterin (Sephience)
🧪 JNT-517, and MZE782
🩸 At-home phe monitors
🗓️ Published on PigPen.page (Want to be the first to see my posts? Subscribe for free emails.)
🔗 https://www.pigpen.page/whats-in-the-treatment-pipeline/
#PKU #Phenylketonuria #RareDisease #InheritedMetabolicDisorders #LivingWithPKU #NSPKU
-
🔬 The latest on PKU treatment from NSPKU's October conference - and what they might mean for those living with PKU.
💊 Sepiapterin (Sephience)
🧪 JNT-517, and MZE782
🩸 At-home phe monitors
🗓️ Published on PigPen.page (Want to be the first to see my posts? Subscribe for free emails.)
🔗 https://www.pigpen.page/whats-in-the-treatment-pipeline/
#PKU #Phenylketonuria #RareDisease #InheritedMetabolicDisorders #LivingWithPKU #NSPKU
-
@poconnor has wrote a new newsletter about what she came away with at the NSPKU. It's exciting stuff!
-
@poconnor has wrote a new newsletter about what she came away with at the NSPKU. It's exciting stuff!
-
A great NSPKU conference in Cardiff yesterday. Lovely to see so many new faces, a reminder to head out beyond the usual places.
Lots of updates, new products and research coming. Just organising my thoughts and will report in the blog soon!
-
Aviation weather for Sultan Syarif Kasim Ii (Simpang Tiga) airport in Pekanbaru-Sumatra Island area (Indonesia) is “WIBB 120200Z 33004KT 8000 SCT012 25/25 Q1011 NOSIG” : See what it means on https://www.bigorre.org/aero/meteo/wibb/en #pekanbarusumatraisland #indonesia #sultansyarifkasimiisimpangtigaairport #wibb #pku #metar #aviation #aviationweather #avgeek #airport vl
-
Watched this by @phenylketonurianotebook very interesting (and my goblin brain appreciates the YT short):
-
Watched this by @phenylketonurianotebook very interesting (and my goblin brain appreciates the YT short):
-
🆕 Tips for Managing Prescriptions and Travelling with #PKU
Earlier this summer I had a great conversation with Tom and Jasmine for this new podcast by the NSPKU.
It was full of tips for:
- dealing with GPs
- packing for PKU,
- managing protein while travellingand just talking about how we manage our PKU "Home & Away"
Would like to know what you think of it!
-
New #openaccess publication #SciPost #Physics
Z2 topological orders in kagome dipolar systems: Feedback from Rydberg quantum simulator
Pengwei Zhao, Gang v. Chen
SciPost Phys. 19, 040 (2025)
https://scipost.org/SciPostPhys.19.2.040