#twinklekhanna — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #twinklekhanna, aggregated by home.social.
-
Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope
Actor Bipasha Basu has raised concerns about the quality of a protein powder after claiming that she found…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Nutrition #adulteratedproducts #BipashaBasu #foodsafetyMaharashtra #Health #InstagramStoriescomplaint #Isopureproteinpowder #MaharashtraFDA #PreityZinta #proteinpowderworms #TukaramMundhe #TwinkleKhanna
https://www.newsbeep.com/us/843619/ -
Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope
Actor Bipasha Basu has raised concerns about the quality of a protein powder after claiming that she found…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Nutrition #adulteratedproducts #BipashaBasu #foodsafetyMaharashtra #Health #InstagramStoriescomplaint #Isopureproteinpowder #MaharashtraFDA #PreityZinta #proteinpowderworms #TukaramMundhe #TwinkleKhanna
https://www.newsbeep.com/us/843619/ -
Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope
Actor Bipasha Basu has raised concerns about the quality of a protein powder after claiming that she found…
#NewsBeep #News #Nutrition #adulteratedproducts #AU #Australia #BipashaBasu #foodsafetyMaharashtra #Health #InstagramStoriescomplaint #Isopureproteinpowder #MaharashtraFDA #PreityZinta #proteinpowderworms #TukaramMundhe #TwinkleKhanna
https://www.newsbeep.com/au/887480/ -
Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope
Actor Bipasha Basu has raised concerns about the quality of a protein powder after claiming that she found…
#NewsBeep #News #Nutrition #adulteratedproducts #AU #Australia #BipashaBasu #foodsafetyMaharashtra #Health #InstagramStoriescomplaint #Isopureproteinpowder #MaharashtraFDA #PreityZinta #proteinpowderworms #TukaramMundhe #TwinkleKhanna
https://www.newsbeep.com/au/887480/ -
https://www.europesays.com/uk/1197738/ Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope #AdulteratedProducts #BipashaBasu #FoodSafetyMaharashtra #Health #InstagramStoriesComplaint #IsopureProteinPowder #MaharashtraFDA #Nutrition #PreityZinta #ProteinPowderWorms #TukaramMundhe #TwinkleKhanna #UK #UnitedKingdom
-
Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope
Actor Bipasha Basu has raised concerns about the quality of a protein powder after claiming that she found…
#NewsBeep #News #Nutrition #adulteratedproducts #BipashaBasu #foodsafetyMaharashtra #Health #InstagramStoriescomplaint #Isopureproteinpowder #MaharashtraFDA #PreityZinta #proteinpowderworms #TukaramMundhe #TwinkleKhanna #UK #UnitedKingdom
https://www.newsbeep.com/uk/766610/ -
https://www.europesays.com/ie/682131/ Bipasha Basu finds worms in protein powder, calls Tukaram Mundhe only hope #AdulteratedProducts #BipashaBasu #Éire #FoodSafetyMaharashtra #Health #IE #InstagramStoriesComplaint #Ireland #IsopureProteinPowder #MaharashtraFDA #Nutrition #PreityZinta #ProteinPowderWorms #TukaramMundhe #TwinkleKhanna
-
Suneel Darshan: ‘Twinkle Khanna wasn’t capable enough,’ says Suneel Darshan wasn’t happy with her casting in ‘Mela’: ‘Didn’t like how she spoke about the film, no dignity’ | Hindi Movie News
Filmmaker Suneel Darshan has once again voiced…
#NewsBeep #News #Celebrities #AamirKhanMela #akshaykumar #AU #Australia #Entertainment #FaisalKhan #Melafilmreview #SuneelDarshan #SuneelDarshancriticisms #TwinkleKhanna #TwinkleKhannajokesaboutMela #TwinkleKhannaMelacasting
https://www.newsbeep.com/au/832211/ -
Suneel Darshan: ‘Twinkle Khanna wasn’t capable enough,’ says Suneel Darshan wasn’t happy with her casting in ‘Mela’: ‘Didn’t like how she spoke about the film, no dignity’ | Hindi Movie News
Filmmaker Suneel Darshan has once again voiced…
#NewsBeep #News #Celebrities #AamirKhanMela #akshaykumar #AU #Australia #Entertainment #FaisalKhan #Melafilmreview #SuneelDarshan #SuneelDarshancriticisms #TwinkleKhanna #TwinkleKhannajokesaboutMela #TwinkleKhannaMelacasting
https://www.newsbeep.com/au/832211/ -
Govinda: When Govinda opened up about why ‘Coolie No. 1’ remake didn’t work: ‘Invested money and lost around Rs 16 crore, was treated badly by some people’ | Hindi Movie News
Govinda, now trending on ‘Lock Upp’ after appearances on Kajol-Twinkle’s show and Kapil Sharma’s show, revisits his 2021…
#NewsBeep #News #Celebrities #AU #Australia #Entertainment #Govinda #Kajol #kapilsharma #TheKapilSharmaShow #TwinkleKhanna #Yashvardhan
https://www.newsbeep.com/au/793750/ -
Govinda: When Govinda opened up about why ‘Coolie No. 1’ remake didn’t work: ‘Invested money and lost around Rs 16 crore, was treated badly by some people’ | Hindi Movie News
Govinda, now trending on ‘Lock Upp’ after appearances on Kajol-Twinkle’s show and Kapil Sharma’s show, revisits his 2021…
#NewsBeep #News #Celebrities #AU #Australia #Entertainment #Govinda #Kajol #kapilsharma #TheKapilSharmaShow #TwinkleKhanna #Yashvardhan
https://www.newsbeep.com/au/793750/ -
https://www.europesays.com/ie/553442/ Akshay Kumar says wife Twinke Khanna is his harshest critic: ‘She can kill me anytime, you can’t say anything’ | Hindi Movie News #AkshayKumar #BollywoodRelationships #ComedyFilms #DirectorAhmedKhan #DishaPatani #Éire #Entertainment #HarshestCritic #IE #Ireland #JacquelineFernandez #Movies #TwinkleKhanna #WelcomeToTheJungle
-
When Twinkle Khanna reacted to rumours about Rajesh Khanna and Dimple Kapadia: ‘The people in magazines were not my parents’ | Hindi Movie News
Being the daughter of two of Bollywood’s biggest stars mean…
#NewsBeep #News #Entertainment #AU #Australia #Bollywood #DimpleKapadia #JaavedJaaferi #nitarabhatia #RajeshKhanna #rajeshkhannadimplekapadiadaughtertwinklekhanna #rajeshkhannadimplekapadiarumours #twinkle #TwinkleKhanna #twinklekhannarelationshipwithparents
https://www.newsbeep.com/au/735063/ -
When Twinkle Khanna reacted to rumours about Rajesh Khanna and Dimple Kapadia: ‘The people in magazines were not my parents’ | Hindi Movie News
Being the daughter of two of Bollywood’s biggest stars mean…
#NewsBeep #News #Entertainment #AU #Australia #Bollywood #DimpleKapadia #JaavedJaaferi #nitarabhatia #RajeshKhanna #rajeshkhannadimplekapadiadaughtertwinklekhanna #rajeshkhannadimplekapadiarumours #twinkle #TwinkleKhanna #twinklekhannarelationshipwithparents
https://www.newsbeep.com/au/735063/ -
When Twinkle Khanna reacted to rumours about Rajesh Khanna and Dimple Kapadia: ‘The people in magazines were not my parents’ | Hindi Movie News
Being the daughter o…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #Bollywood #DimpleKapadia #Entertainment #JaavedJaaferi #NitaraBhatia #RajeshKhanna #rajeshkhannadimplekapadiadaughtertwinklekhanna #rajeshkhannadimplekapadiarumours #twinkle #TwinkleKhanna #twinklekhannarelationshipwithparents
https://www.newsbeep.com/us/702502/ -
When Twinkle Khanna reacted to rumours about Rajesh Khanna and Dimple Kapadia: ‘The people in magazines were not my parents’ | Hindi Movie News
Being the daughter o…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #Bollywood #DimpleKapadia #Entertainment #JaavedJaaferi #NitaraBhatia #RajeshKhanna #rajeshkhannadimplekapadiadaughtertwinklekhanna #rajeshkhannadimplekapadiarumours #twinkle #TwinkleKhanna #twinklekhannarelationshipwithparents
https://www.newsbeep.com/us/702502/ -
https://www.europesays.com/ie/533885/ When Twinkle Khanna reacted to rumours about Rajesh Khanna and Dimple Kapadia: ‘The people in magazines were not my parents’ | Hindi Movie News #Bollywood #DimpleKapadia #Éire #Entertainment #IE #Ireland #JaavedJaaferi #Movies #NitaraBhatia #RajeshKhanna #RajeshKhannaDimpleKapadiaDaughterTwinkleKhanna #RajeshKhannaDimpleKapadiaRumours #twinkle #TwinkleKhanna #TwinkleKhannaRelationshipWithParents
-
Forget handmade cards, Twinkle Khanna reveals the one Mother’s Day gift every mom secretly wants https://english.mathrubhumi.com/movies-music/twinkle-khanna-zero-responsibilities-mothers-day-quote-q0kyd1uw?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #MothersDay #CelebrityMoms #ParentingTruths
-
Forget handmade cards, Twinkle Khanna reveals the one Mother’s Day gift every mom secretly wants https://english.mathrubhumi.com/movies-music/twinkle-khanna-zero-responsibilities-mothers-day-quote-q0kyd1uw?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #MothersDay #CelebrityMoms #ParentingTruths
-
Forget handmade cards, Twinkle Khanna reveals the one Mother’s Day gift every mom secretly wants https://english.mathrubhumi.com/movies-music/twinkle-khanna-zero-responsibilities-mothers-day-quote-q0kyd1uw?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #MothersDay #CelebrityMoms #ParentingTruths
-
Forget handmade cards, Twinkle Khanna reveals the one Mother’s Day gift every mom secretly wants https://english.mathrubhumi.com/movies-music/twinkle-khanna-zero-responsibilities-mothers-day-quote-q0kyd1uw?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #MothersDay #CelebrityMoms #ParentingTruths
-
Twinkle Khanna offered a candid glimpse into her writing life, sharing how her husband Akshay Kumar’s trademark one-line phrase is the extent of his creative input. https://english.mathrubhumi.com/movies-music/news/twinkle-khanna-akshay-kumar-creative-input-to-writing-career-jrqvrpr2?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #AkshayKumar #CelebrityCouple
-
Twinkle Khanna offered a candid glimpse into her writing life, sharing how her husband Akshay Kumar’s trademark one-line phrase is the extent of his creative input. https://english.mathrubhumi.com/movies-music/news/twinkle-khanna-akshay-kumar-creative-input-to-writing-career-jrqvrpr2?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #AkshayKumar #CelebrityCouple
-
Twinkle Khanna offered a candid glimpse into her writing life, sharing how her husband Akshay Kumar’s trademark one-line phrase is the extent of his creative input. https://english.mathrubhumi.com/movies-music/news/twinkle-khanna-akshay-kumar-creative-input-to-writing-career-jrqvrpr2?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #AkshayKumar #CelebrityCouple
-
Lara Dutta says Akshay Kumar never took advantage of Priyanka Chopra and her: ‘Two young girls with stars in their eyes..’ |
Priyanka Chopra and Lara Dutta both rose to fame after winning international beauty pageants in 2000, and they…
#NewsBeep #News #Celebrities #akshaykumar #Andaaz #bollywoodnews #Entertainment #LaraDutta #NickJonas #PriyankaChopra #SuneelDarshan #TwinkleKhanna #UK #UnitedKingdom
https://www.newsbeep.com/uk/523475/ -
https://www.europesays.com/ie/412850/ Akshay Kumar admits feeling inferior in front of educated people: ‘Kabhi kabhi bahut chhota mehsoos karta hoon’ | Hindi Movie News #AkshayKumar #BhoothBangla #Celebrities #CelebrityInterviews #education #Éire #Entertainment #IE #InferiorityComplex #Ireland #PersonalGrowth #priyadarshan #ReadingBooks #SelfImprovement #TwinkleKhanna
-
Akshay Kumar admits feeling inferior in front of educated people: ‘Kabhi kabhi bahut chhota mehsoos karta hoon’ | Hindi Movie News
Akshay Kumar openly shared his feelings of insecurity when around well-educated people, jokingly pondering a return to ac…
#NewsBeep #News #Movies #akshaykumar #AU #Australia #BhoothBangla #celebrityinterviews #Education #Entertainment #inferioritycomplex #personalgrowth #priyadarshan #readingbooks #Self-improvement #TwinkleKhanna
https://www.newsbeep.com/au/575798/ -
Akshay Kumar admits feeling inferior in front of educated people: ‘Kabhi kabhi bahut chhota mehsoos karta hoon’ | Hindi Movie News
Akshay Kumar openly shared his feelings of insecurity when around well-educated people, jokingly pondering a return to ac…
#NewsBeep #News #Movies #akshaykumar #AU #Australia #BhoothBangla #celebrityinterviews #Education #Entertainment #inferioritycomplex #personalgrowth #priyadarshan #readingbooks #Self-improvement #TwinkleKhanna
https://www.newsbeep.com/au/575798/ -
https://www.europesays.com/ie/385541/ Akshay Kumar reacts to being clicked with Twinkle Khanna, kids after Jaya Bachchan’s comment on paps: ‘Photographer earns Rs 3,500 – Rs 4,000′ | Hindi Movie News #AirportPaps #AkshayKumar #CelebrityComments #Éire #Entertainment #FameAndStardom #IE #Ireland #JayaBachchan #Movies #PaparazziCulture #paps #PhotographerEarnings #TwinkleKhanna
-
When Akshay Kumar spoke about extra-marital relationships: ‘If you forgive your partner, you will come out as a winner’ |
A while ago, Akshay Kumar‘s wife, Twinkle Khanna was in the news for her take…
#NewsBeep #News #Movies #akshaykumar #AkshayKumarextra-maritalrelationships #AkshayKumarTwinkleKhanna #AU #Australia #Entertainment #forgivenessinrelationships #JanhviKapoor #KaranJohar #Rustommovieinfidelitytheme #TwinkleKhanna #TwinkleKhannaopiniononinfidelity
https://www.newsbeep.com/au/533818/ -
When Akshay Kumar spoke about extra-marital relationships: ‘If you forgive your partner, you will come out as a winner’ |
A while ago, Akshay Kumar‘s wife, Twinkle Khanna was in the news for her take…
#NewsBeep #News #Movies #akshaykumar #AkshayKumarextra-maritalrelationships #AkshayKumarTwinkleKhanna #AU #Australia #Entertainment #forgivenessinrelationships #JanhviKapoor #KaranJohar #Rustommovieinfidelitytheme #TwinkleKhanna #TwinkleKhannaopiniononinfidelity
https://www.newsbeep.com/au/533818/ -
https://www.europesays.com/ie/379908/ When Akshay Kumar spoke about extra-marital relationships: ‘If you forgive your partner, you will come out as a winner’ | #AkshayKumar #AkshayKumarExtraMaritalRelationships #AkshayKumarTwinkleKhanna #Éire #Entertainment #ForgivenessInRelationships #IE #Ireland #JanhviKapoor #KaranJohar #Movies #RustomMovieInfidelityTheme #TwinkleKhanna #TwinkleKhannaOpinionOnInfidelity
-
Twinkle Khanna opens up on painful side of motherhood after her son Aarav entered his 20s: ‘The obligation to let go…’
Actor-turned-author Twinkle Khanna recently opened up about the bittersweet journey of motherhood. Reflecting on her relationship with her…
#NewsBeep #News #Movies #Aarav #akshaykumar #AU #Australia #DimpleKapadia #Entertainment #TwinkleKhanna
https://www.newsbeep.com/au/526992/ -
Twinkle Khanna opens up on painful side of motherhood after her son Aarav entered his 20s: ‘The obligation to let go…’
Actor-turned-author Twinkle Khanna recently opened up about the bittersweet journey of motherhood. Reflecting on her relationship with her…
#NewsBeep #News #Movies #Aarav #akshaykumar #AU #Australia #DimpleKapadia #Entertainment #TwinkleKhanna
https://www.newsbeep.com/au/526992/ -
https://www.europesays.com/ie/374443/ Twinkle Khanna opens up on painful side of motherhood after her son Aarav entered his 20s: ‘The obligation to let go…’ #Aarav #AkshayKumar #DimpleKapadia #Éire #Entertainment #IE #Ireland #Movies #TwinkleKhanna
-
https://www.europesays.com/ie/351966/ Akshay Kumar shares hilarious story of how his college crush once got him beaten up: ‘I really liked that girl…’ | Hindi Movie News #AkshayKumar #Bollywood #DimpleKapadia #Éire #Entertainment #IE #Ireland #Movies #RajeshKhanna #TwinkleKhanna
-
Rajesh Khanna refused to go downstairs to meet Akshay Kumar, recalls Raju Shrestha: ‘Main uska sasur hoon… main kyun jaoon’ | Hindi Movie News
Raju Shrestha, popularly known as Master Raju, has shared more anecdotes highlighting Rajesh Khanna’s…
#NewsBeep #News #Celebrities #akshay #akshaykumar #Entertainment #hemamalini #masterraju #RajeshKhanna #rajeshkhannaakshaykumar #RajeshKhannaego #RajeshKhannapersonality #RajuShrestha #TwinkleKhanna #UK #UnitedKingdom
https://www.newsbeep.com/uk/417176/ -
https://www.europesays.com/ie/329040/ Rajesh Khanna refused to go downstairs to meet Akshay Kumar, recalls Raju Shrestha: ‘Main uska sasur hoon… main kyun jaoon’ | Hindi Movie News #akshay #AkshayKumar #Celebrities #Éire #Entertainment #HemaMalini #IE #Ireland #MasterRaju #RajeshKhanna #RajeshKhannaAkshayKumar #RajeshKhannaEgo #RajeshKhannaPersonality #RajuShrestha #TwinkleKhanna
-
Twinkle Khanna says menopause made her feel like ‘a phone with a faulty charger’; shares 8 supplements that helped her
Twinkle Khanna has been quite open about her menopause journey, and in her recent Instagram post shared on…
#NewsBeep #News #Nutrition #Health #healthsupplements #HormoneReplacementTherapy #menopausejourney #mentalwellbeing #structuredroutine #TwinkleKhanna #UK #UnitedKingdom
https://www.newsbeep.com/uk/391761/ -
https://www.europesays.com/ie/304313/ At 52, Twinkle Khanna opens up about struggles of menopause: Here’s what can help #Celebrities #Éire #Entertainment #IE #Ireland #Menopause #MenopauseRelief #SupplementsForMenopause #TwinkleKhanna #TwinkleKhannaInstagram #TwinkleKhannaOnMenopause #TwinkleKhannaOnStrugglesOfMenopause #WhatCanHelpMenopause
-
https://www.europesays.com/ie/303769/ Twinkle Khanna says menopause made her feel like ‘a phone with a faulty charger’; shares 8 supplements that helped her #Éire #Health #HealthSupplements #HormoneReplacementTherapy #IE #Ireland #MenopauseJourney #MentalWellbeing #Nutrition #StructuredRoutine #TwinkleKhanna
-
Akshay Kumar recalls Dimple Kapadia’s warning to him when he married Twinkle Khanna; goes paragliding on 25th anniversary – VIDEO | Hindi Movie News
Akshay Kumar and Twinkle Kapadia celebrate their 25th anniversary today, January 17. The couple …
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #25thanniversary #AkshayKumar #celebritycouple #DimpleKapadia #Entertainment #marriageadvice #NeenaGupta #paragliding #RajeshKhanna #TwinkleKhanna
https://www.newsbeep.com/us/413395/ -
Akshay Kumar recalls Dimple Kapadia’s warning to him when he married Twinkle Khanna; goes paragliding on 25th anniversary – VIDEO | Hindi Movie News
Akshay Kumar and Twinkle Kapadia celebrate their 25th anniversary today, January 17. The couple …
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #25thanniversary #AkshayKumar #celebritycouple #DimpleKapadia #Entertainment #marriageadvice #NeenaGupta #paragliding #RajeshKhanna #TwinkleKhanna
https://www.newsbeep.com/us/413395/ -
https://www.europesays.com/ie/289587/ Akshay Kumar recalls Dimple Kapadia’s warning to him when he married Twinkle Khanna; goes paragliding on 25th anniversary – VIDEO | Hindi Movie News #25thAnniversary #AkshayKumar #Celebrities #CelebrityCouple #DimpleKapadia #Éire #Entertainment #IE #Ireland #MarriageAdvice #NeenaGupta #Paragliding #RajeshKhanna #TwinkleKhanna
-
https://www.europesays.com/ie/289369/ Akshay Kumar celebrates 25th wedding anniversary with Twinkle Khanna, shares her dance video: ‘Cheers to my lady who…’ #AkshayKumar #BollywoodCouple #Celebrities #Éire #Entertainment #IE #Ireland #TwinkleKhanna #UpcomingFilms #WeddingAnniversary
-
Gautami Kapoor reacts to Kajol and Twinkle Khanna’s infidelity remarks: ‘There are too many options, temptations, and no patience’ | Hindi Movie News
Kajol and Twinkle Khanna recently f…
#NewsBeep #News #Entertainment #AU #Australia #GautamiKapoor #GautamiKapoorinfidelityremarks #GautamiKapoorloyaltyperspective #infidelityinmarriage #JanhviKapoor #Kajol #kajoltwinklekhannainfidelityremarks #KajolTwinkleKhannamarriagecomments #marriageexpirydate #TwinkleKhanna
https://www.newsbeep.com/au/398577/ -
When Twinkle Khanna opened up on melasma, calling it a ‘bin bulaya mehman’: here’s what we know on the condition
In 2023, former actor turned author Twinkle Khanna, revealed her experience with melasma, calling it an “uninvited guest”…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Health #arbutin #Fitzpatrick #iiiv #kojic #melasma #motherindia #tca #TwinkleKhanna
https://www.newsbeep.com/us/387637/ -
Kajol, Twinkle Khanna’s ‘Two Much’ Becomes Prime Video India’s Most-Watched Unscripted Series (EXCLUSIVE)
#Variety #Asia #Global #News #Kajol #PrimeVideo #TwinkleKhanna #TwoMuchwithKajolandTwinkle -
Kajol, Twinkle Khanna’s ‘Two Much’ Becomes Prime Video India’s Most-Watched Unscripted Series (EXCLUSIVE)
#Variety #Asia #Global #News #Kajol #PrimeVideo #TwinkleKhanna #TwoMuchwithKajolandTwinkle -
Kajol, Twinkle Khanna’s ‘Two Much’ Becomes Prime Video India’s Most-Watched Unscripted Series (EXCLUSIVE)
#Variety #Asia #Global #News #Kajol #PrimeVideo #TwinkleKhanna #TwoMuchwithKajolandTwinkle -
Kajol, Twinkle Khanna’s ‘Two Much’ Becomes Prime Video India’s Most-Watched Unscripted Series (EXCLUSIVE)
#Variety #Asia #Global #News #Kajol #PrimeVideo #TwinkleKhanna #TwoMuchwithKajolandTwinkle -
‘Apko nahi laga?’: Kajol admits Salman Khan, Aamir Khan avoided question on age gap in Bollywood |
Kajol revealed Salman Khan and Aamir Khan skillfully avoided her question about age gaps between older male stars…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #AamirKhan #Agegap #Entertainment #kajol #KajoltwinkleKhanna #SalmanAamirKhan #SalmanKhan #ShahRukhKhan #SitaareZameenPar #SunnyDeol #TwinkleKhanna
https://www.newsbeep.com/us/223585/ -
Twinkle Khanna, Kajol, Rani Mukerji and Bipasha Basu joined Mumbai’s Durga Puja celebrations. The festive outing comes as Kajol and Twinkle launch their new chat show. https://english.mathrubhumi.com/movies-music/news/from-durga-puja-glamour-to-two-much-revelations-twinkle-khanna-and-kajols-latest-appearances-ae8av3j1?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #Kajol #DurgaPuja #BollywoodStars
-
Twinkle Khanna, Kajol, Rani Mukerji and Bipasha Basu joined Mumbai’s Durga Puja celebrations. The festive outing comes as Kajol and Twinkle launch their new chat show. https://english.mathrubhumi.com/movies-music/news/from-durga-puja-glamour-to-two-much-revelations-twinkle-khanna-and-kajols-latest-appearances-ae8av3j1?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #Kajol #DurgaPuja #BollywoodStars
-
Twinkle Khanna, Kajol, Rani Mukerji and Bipasha Basu joined Mumbai’s Durga Puja celebrations. The festive outing comes as Kajol and Twinkle launch their new chat show. https://english.mathrubhumi.com/movies-music/news/from-durga-puja-glamour-to-two-much-revelations-twinkle-khanna-and-kajols-latest-appearances-ae8av3j1?utm_source=dlvr.it&utm_medium=mastodon #TwinkleKhanna #Kajol #DurgaPuja #BollywoodStars
-
‘He used to treat me like an assistant’: Aamir Khan reveals why he refused to work with Salman Khan after Andaz Apna Apna |
Aamir Khan revealed his initial dislike for Salman Khan during ‘Andaz Apna Apna’ due to Salman’s tardiness and…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #AamirKhan #AamirKhanSalmanKhan #AndazApnaApna #divorce #Entertainment #JunaidKhan #kiranrao #LaalSinghChaddha #reenadutta #SalmanKhan #TwinkleKhanna
https://www.newsbeep.com/us/182784/ -
Twinkle Khanna reveals growing up in all-women household kept her away from patriarchy: ‘I didn’t know there was inequality…’ |
Twinkle Khanna, daughter of Dimple Kapadia, grew up in a matriarchal home, shielded from patriarchal…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #AaravBhatia #AkshayKumar #all-womenhousehold #BobbyDeol #DimpleKapadia #Entertainment #genderinequality #NitaraBhatia #patriarchy #TwinkleKhanna #womenempowerment
https://www.newsbeep.com/us/137714/ -
Suneel Darshan on not replacing Priyanka Chopra in Barsaat after Akshay Kumar’s exit amid personal turbulence: ‘Shaadishuda aadmiyon ko zyada responsible hona chahiye’ |
Filmmaker Suneel Darshan, who is known for directing hit collabo…
#NewsBeep #News #US #USA #UnitedStates #UnitedStatesOfAmerica #Movies #akshay #AkshayKumar #AkshayPriyankarelationshiprumors #Andaaz2 #Barsaatfilm #BobbyDeol #Entertainment #Priyanka #PriyankaChopra #SuneelDarshan #TwinkleKhanna
https://www.newsbeep.com/us/59645/ -
Kajol, Twinkle Khanna to Host Prime Video and Banijay Asia’s New Talk Show (EXCLUSIVE)
#Variety #Asia #Global #News #BanijayAsia #Kajol #PrimeVideo #TwinkleKhannahttps://variety.com/2025/tv/news/kajol-twinkle-khanna-prime-video-banijay-asia-talk-show-1236465820/
-
Kajol, Twinkle Khanna to Host Prime Video and Banijay Asia’s New Talk Show (EXCLUSIVE)
#Variety #Asia #Global #News #BanijayAsia #Kajol #PrimeVideo #TwinkleKhannahttps://variety.com/2025/tv/news/kajol-twinkle-khanna-prime-video-banijay-asia-talk-show-1236465820/