#gladstone — Public Fediverse posts
Live and recent posts from across the Fediverse tagged #gladstone, aggregated by home.social.
-
Police: Garden man arrested for illegally possessing over 35 guns | News https://www.allforgardening.com/1842546/police-garden-man-arrested-for-illegally-possessing-over-35-guns-news/ #drugs #garden #GardenTownship #gladstone #MichiganStatePolice #MSP #weapons
-
Police: Garden man arrested for illegally possessing over 35 guns | News https://www.allforgardening.com/1842546/police-garden-man-arrested-for-illegally-possessing-over-35-guns-news/ #drugs #garden #GardenTownship #gladstone #MichiganStatePolice #MSP #weapons
-
#GLADSTONE #PARK #SECONDARY #COLLEGE chatgpt.com?prompt=Analy... #EDITH L #KING chatgpt.com?prompt=Analy... www.paypal.com/donate?busin... aePiot: SEO is changing. Build Web 4.0 nodes with aePiot.
ChatGPT -
#GLADSTONE #PARK #SECONDARY #COLLEGE chatgpt.com?prompt=Analy... #EDITH L #KING chatgpt.com?prompt=Analy... www.paypal.com/donate?busin... aePiot: SEO is changing. Build Web 4.0 nodes with aePiot.
ChatGPT -
wanna be stuck on an island for a while? :blobcat_smilehappyeyes: :ablobwobble: 🎣 #gladstone #qld #NorthWestIsland
https://www.abc.net.au/news/2026-04-26/campground-hosting-on-qld-national-park-islands/106563278
-
wanna be stuck on an island for a while? :blobcat_smilehappyeyes: :ablobwobble: 🎣 #gladstone #qld #NorthWestIsland
https://www.abc.net.au/news/2026-04-26/campground-hosting-on-qld-national-park-islands/106563278
-
wanna be stuck on an island for a while? :blobcat_smilehappyeyes: :ablobwobble: 🎣 #gladstone #qld #NorthWestIsland
https://www.abc.net.au/news/2026-04-26/campground-hosting-on-qld-national-park-islands/106563278
-
wanna be stuck on an island for a while? :blobcat_smilehappyeyes: :ablobwobble: 🎣 #gladstone #qld #NorthWestIsland
https://www.abc.net.au/news/2026-04-26/campground-hosting-on-qld-national-park-islands/106563278
-
wanna be stuck on an island for a while? :blobcat_smilehappyeyes: :ablobwobble: 🎣 #gladstone #qld #NorthWestIsland
https://www.abc.net.au/news/2026-04-26/campground-hosting-on-qld-national-park-islands/106563278
-
Federal and state governments announce $2b bailout for Rio Tinto’s Boyne aluminium smelter
Rio Tinto, the federal and state governments, have struck a landmark partnership to secure the long-term future of…
#NewsBeep #News #Business #Albanesegovernment #aluminiumsmelter #AU #Australia #boynesmelter #CentralQueensland #Federalgovernment #gladstone #Jobs #renewablesenergy #riotinto #stategovernment
https://www.newsbeep.com/au/562284/ -
Federal and state governments announce $2b bailout for Rio Tinto’s Boyne aluminium smelter
Rio Tinto, the federal and state governments, have struck a landmark partnership to secure the long-term future of…
#NewsBeep #News #Business #Albanesegovernment #aluminiumsmelter #AU #Australia #boynesmelter #CentralQueensland #Federalgovernment #gladstone #Jobs #renewablesenergy #riotinto #stategovernment
https://www.newsbeep.com/au/562284/ -
Saltwater crocodile found in dam hundreds of kilometres from normal habitat
A saltwater crocodile measuring 2.3 metres has been spotted in a dam west of Brisbane, hundreds of kilometres…
#NewsBeep #News #Wildlife #Brisbane #croc #crocodile #dam #departmentofenvironment #estuarine #gatton #gladstone #Qld #Queensland #saltwater #saltie #Saltwater #Science #sighting #UK #UnitedKingdom
https://www.newsbeep.com/uk/465835/ -
https://www.europesays.com/uk/814268/ Saltwater crocodile found in dam hundreds of kilometres from normal habitat #Brisbane #croc #crocodile #dam #DepartmentOfEnvironment #estuarine #gatton #gladstone #qld #queensland #SaltWater #saltie #Saltwater #Science #sighting #UK #UnitedKingdom #wildlife
-
Saltwater crocodile found in dam hundreds of kilometres from normal habitat
A saltwater crocodile measuring 2.3 metres has been spotted in a dam west of Brisbane, hundreds of kilometres…
#NewsBeep #News #Wildlife #AU #Australia #Brisbane #croc #crocodile #dam #departmentofenvironment #estuarine #gatton #gladstone #Qld #Queensland #saltwater #saltie #Science #sighting
https://www.newsbeep.com/au/528442/ -
Saltwater crocodile found in dam hundreds of kilometres from normal habitat
A saltwater crocodile measuring 2.3 metres has been spotted in a dam west of Brisbane, hundreds of kilometres…
#NewsBeep #News #Wildlife #AU #Australia #Brisbane #croc #crocodile #dam #departmentofenvironment #estuarine #gatton #gladstone #Qld #Queensland #saltwater #saltie #Science #sighting
https://www.newsbeep.com/au/528442/ -
We had a good bit of rain here in #Gladstone #QLD
-
We had a good bit of rain here in #Gladstone #QLD
-
We had a good bit of rain here in #Gladstone #QLD
-
We had a good bit of rain here in #Gladstone #QLD
-
We had a good bit of rain here in #Gladstone #QLD
-
North West Island on the Great Barrier Reef declared rat-free
North West Island is home to hundreds of thousands of vulnerable seabirds and nes…
#NewsBeep #News #Wildlife #AU #Australia #birds #blackrats #CapricorniaCays #capricorniacaysnationalparkandgreatbarrierreefworldheritage #DamonShearer #gladstone #GreatBarrierReef #invasivepests #NorthWestIsland #pestmanagement #queenslandparksandwildlifeservice #Science #shearwater #SouthernGreatBarrierReef #turtles
https://www.newsbeep.com/au/524102/ -
North West Island on the Great Barrier Reef declared rat-free
North West Island is home to hundreds of thousands of vulnerable seabirds and nes…
#NewsBeep #News #Wildlife #AU #Australia #birds #blackrats #CapricorniaCays #capricorniacaysnationalparkandgreatbarrierreefworldheritage #DamonShearer #gladstone #GreatBarrierReef #invasivepests #NorthWestIsland #pestmanagement #queenslandparksandwildlifeservice #Science #shearwater #SouthernGreatBarrierReef #turtles
https://www.newsbeep.com/au/524102/ -
Labor’s Gladstone Inland Rail Promise Off Rails http://dlvr.it/TQsxky #ARTC #InlandRail #RailNews #Gladstone
-
Labor’s Gladstone Inland Rail Promise Off Rails http://dlvr.it/TQsxky #ARTC #InlandRail #RailNews #Gladstone
-
Labor’s Gladstone Inland Rail Promise Off Rails http://dlvr.it/TQsxky #ARTC #InlandRail #RailNews #Gladstone
-
Labor’s Gladstone Inland Rail Promise Off Rails http://dlvr.it/TQsxky #ARTC #InlandRail #RailNews #Gladstone
-
Labor’s Gladstone Inland Rail Promise Off Rails http://dlvr.it/TQsxky #ARTC #InlandRail #RailNews #Gladstone
-
Gladstone company taking centre stage in AI revolution, providing a critical mineral to cool computer chips
Gladstone is one o…
#NewsBeep #News #Business #AlphaHPA #AU #Australia #China #ComputerChips #Computers #criticalminerals #gladstone #HighPurityAlumina #industry #manufacturing #NorthernAustraliaInfrastructureFund #Orica #PhineasGlover #PresidentDonaldTrump #Queensland #QUT #riotinto #RobWiiliamson #RobertPerrons #Russia #Semiconductors #Technology #ubs
https://www.newsbeep.com/au/403023/ -
Three Parts Dead by Max Gladstone
This post originally appeared on the previous incarnation of this blog on April 23, 2024. This was not my first time reading Three Parts Dead. In fact, I pre-ordered it when it first came out and read it then. Max Gladstone just released the second book of a sequel series to the original Craft Sequence books and in getting ready to read the Craft Wars books, I decided to go back and read the original Craft Sequence. Let me begin by saying that my original pre-order was based on the fact that […]https://alexanderkeane.com/2025/12/18/three-parts-dead-by-max-gladstone/
-
Three Parts Dead by Max Gladstone
This post originally appeared on the previous incarnation of this blog on April 23, 2024. This was not my first time reading Three Parts Dead. In fact, I pre-ordered it when it first came out and read it then. Max Gladstone just released the second book of a sequel series to the original Craft Sequence books and in getting ready to read the Craft Wars books, I decided to go back and read the original Craft Sequence. Let me begin by saying that my original pre-order was based on the fact that […]https://alexanderkeane.com/2025/12/18/three-parts-dead-by-max-gladstone/
-
Three Parts Dead by Max Gladstone
This post originally appeared on the previous incarnation of this blog on April 23, 2024. This was not my first time reading Three Parts Dead. In fact, I pre-ordered it when it first came out and read it then. Max Gladstone just released the second book of a sequel series to the original Craft Sequence books and in getting ready to read the Craft Wars books, I decided to go back and read the original Craft Sequence. Let me begin by saying that my original pre-order was based on the fact that […]https://alexanderkeane.com/2025/12/18/three-parts-dead-by-max-gladstone/
-
In the politics of #Ireland & the #UK, the political term #KiteFlying goes back at least to 1885, when #Gladstone's son Herbert flew the "#HawardenKite", i.e. the possibility of Liberal Party support for #IrishHomeRule. https://en.wikipedia.org/wiki/Hawarden_Kite https://en.wiktionary.org/wiki/kite_flying
Now we have a new, crude term for those who disown their kite: #SchrodingersAsshole, the person who angrily denounces their own idea when it generates hostility. https://www.urbandictionary.com/define.php?term=Schrodingers+asshole
h/t @passenger
-
In the politics of #Ireland & the #UK, the political term #KiteFlying goes back at least to 1885, when #Gladstone's son Herbert flew the "#HawardenKite", i.e. the possibility of Liberal Party support for #IrishHomeRule. https://en.wikipedia.org/wiki/Hawarden_Kite https://en.wiktionary.org/wiki/kite_flying
Now we have a new, crude term for those who disown their kite: #SchrodingersAsshole, the person who angrily denounces their own idea when it generates hostility. https://www.urbandictionary.com/define.php?term=Schrodingers+asshole
h/t @passenger
-
In the politics of #Ireland & the #UK, the political term #KiteFlying goes back at least to 1885, when #Gladstone's son Herbert flew the "#HawardenKite", i.e. the possibility of Liberal Party support for #IrishHomeRule. https://en.wikipedia.org/wiki/Hawarden_Kite https://en.wiktionary.org/wiki/kite_flying
Now we have a new, crude term for those who disown their kite: #SchrodingersAsshole, the person who angrily denounces their own idea when it generates hostility. https://www.urbandictionary.com/define.php?term=Schrodingers+asshole
h/t @passenger
-
In the politics of #Ireland & the #UK, the political term #KiteFlying goes back at least to 1885, when #Gladstone's son Herbert flew the "#HawardenKite", i.e. the possibility of Liberal Party support for #IrishHomeRule. https://en.wikipedia.org/wiki/Hawarden_Kite https://en.wiktionary.org/wiki/kite_flying
Now we have a new, crude term for those who disown their kite: #SchrodingersAsshole, the person who angrily denounces their own idea when it generates hostility. https://www.urbandictionary.com/define.php?term=Schrodingers+asshole
h/t @passenger
-
In the politics of #Ireland & the #UK, the political term #KiteFlying goes back at least to 1885, when #Gladstone's son Herbert flew the "#HawardenKite", i.e. the possibility of Liberal Party support for #IrishHomeRule. https://en.wikipedia.org/wiki/Hawarden_Kite https://en.wiktionary.org/wiki/kite_flying
Now we have a new, crude term for those who disown their kite: #SchrodingersAsshole, the person who angrily denounces their own idea when it generates hostility. https://www.urbandictionary.com/define.php?term=Schrodingers+asshole
h/t @passenger
-
Gladstone may be key to Australia’s Inland Rail Project http://dlvr.it/TP9nQv #Australia #Gladstone #Infrastructure #Railfreight
-
Gladstone may be key to Australia’s Inland Rail Project http://dlvr.it/TP9nQv #Australia #Gladstone #Infrastructure #Railfreight
-
Gladstone may be key to Australia’s Inland Rail Project http://dlvr.it/TP9nQv #Australia #Gladstone #Infrastructure #Railfreight
-
Gladstone may be key to Australia’s Inland Rail Project http://dlvr.it/TP9nQv #Australia #Gladstone #Infrastructure #Railfreight
-
Gladstone may be key to Australia’s Inland Rail Project http://dlvr.it/TP9nQv #Australia #Gladstone #Infrastructure #Railfreight
-
'Heol Gladstone' is already in use by the Vale of lamorgan Council for #Gladstone Road and has therefore been added to the @openstreetmap database as part of #Welsh Government's #MapioCymru project.
https://osm.org/go/euOJ~KO_A--?changeset=173660590
Will be online at our https://openstreetmap.cymru map tomorrow
-
'Heol Gladstone' is already in use by the Vale of lamorgan Council for #Gladstone Road and has therefore been added to the @openstreetmap database as part of #Welsh Government's #MapioCymru project.
https://osm.org/go/euOJ~KO_A--?changeset=173660590
Will be online at our https://openstreetmap.cymru map tomorrow
-
'Heol Gladstone' is already in use by the Vale of lamorgan Council for #Gladstone Road and has therefore been added to the @openstreetmap database as part of #Welsh Government's #MapioCymru project.
https://osm.org/go/euOJ~KO_A--?changeset=173660590
Will be online at our https://openstreetmap.cymru map tomorrow
-
'Heol Gladstone' is already in use by the Vale of lamorgan Council for #Gladstone Road and has therefore been added to the @openstreetmap database as part of #Welsh Government's #MapioCymru project.
https://osm.org/go/euOJ~KO_A--?changeset=173660590
Will be online at our https://openstreetmap.cymru map tomorrow
-
A MAGA woman at a #PizzaHut in #Gladstone, #MO, tried to call #ICE on a couple waiting for their food, telling them it’s “English only” in the US She declared, “English is the capital of America,” and ordered them to “self deport back to #PUERTORICO!” “I am not racist, I am standing up for #America”
-
A MAGA woman at a #PizzaHut in #Gladstone, #MO, tried to call #ICE on a couple waiting for their food, telling them it’s “English only” in the US She declared, “English is the capital of America,” and ordered them to “self deport back to #PUERTORICO!” “I am not racist, I am standing up for #America”
-
Rio Tinto’s Gladstone coal-fired power station to close six years early
The Gladstone Power Station will close six years earlier than expected. The station, which is Queensland’s largest and…
#NewsBeep #News #Business #AU #Australia #coal #coalfiredpower #earlypowerstationclosure #Energy #gladstone #PowerStation #riotinto
https://www.newsbeep.com/au/181312/